TkA07G052590 | RubberDandelionOmics

Gene overview

TkA07G052590

Reference: TK1151 Chr: Chr07 Coordinates: 13996996-13997859 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

654 bp · TkA07G052590|TK1151|cDNA

AAAATAGGCACAAATATTACAGGTGGAAAGCCATTGTTGGAATCAAACAGGGTTCTAAGGCCTGGTGGTGTTTTTATATGGTATGCTGCACTAGTGTATCGCGATAATGAAAGAGATAAAAAAGTTTGGGAGTCCATGGTAGCTTTGACTGAATCTATTTGCTGGAAGGTGGTGGCAAAAAGCTTTGATTCATCTGGAATTGGACTTGTTATATACGAGAAGCCTGTTTCTTCTTCCTGTTATGAATCACGTAAAGTTAA...

CDS

Download CDS FASTA

654 bp · TkA07G052590|TK1151|CDS

AAAATAGGCACAAATATTACAGGTGGAAAGCCATTGTTGGAATCAAACAGGGTTCTAAGGCCTGGTGGTGTTTTTATATGGTATGCTGCACTAGTGTATCGCGATAATGAAAGAGATAAAAAAGTTTGGGAGTCCATGGTAGCTTTGACTGAATCTATTTGCTGGAAGGTGGTGGCAAAAAGCTTTGATTCATCTGGAATTGGACTTGTTATATACGAGAAGCCTGTTTCTTCTTCCTGTTATGAATCACGTAAAGTTAA...

Protein

Download Protein FASTA

217 aa · TkA07G052590|TK1151|PROTEIN

KIGTNITGGKPLLESNRVLRPGGVFIWYAALVYRDNERDKKVWESMVALTESICWKVVAKSFDSSGIGLVIYEKPVSSSCYESRKVNNPPVCDEHAHAKTSWYTPLDGCISRIPTKKQWPTPWPQRLKTKPLIDGLQNFDEDTRKWSETVTNVYLETLGVNWSSVRNVMDMNAGYGGFAAALTDLPLWVMNVGTSSGKITCLRLNYHFTLFCVLYIG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G052590`
TK1151 ID	TkA07G052590
OH-1004 ID	LXL04_012202
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.000
Protein coverage (%)	TK1151 85.253 / OH-1004 30.731 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G052590

Location Chr07:13996996-13997859 (-)

Description Similar to At2g40280: Probable methyltransferase PMT23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40280`	Probable methyltransferase PMT23.	No verified direct reference in this release
`At3g56080`	Probable methyltransferase PMT22.	No verified direct reference in this release
`At3g51070`	Probable methyltransferase PMT27.	No verified direct reference in this release
`At2g34300`	Probable methyltransferase PMT25.	No verified direct reference in this release
`At5g64030`	Probable methyltransferase PMT26.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012202 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

KEGG gene cross-reference

ath:AT1G29470

ath:AT2G34300

ath:AT2G40280

ath:AT3G51070

ath:AT3G56080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.421

Rank 1 · TkA07G052590 · TK1151

Extracellular0.152

Rank 2 · TkA07G052590 · TK1151

Endoplasmic reticulum0.139

Rank 3 · TkA07G052590 · TK1151

Lysosome / Vacuole0.063

Rank 4 · TkA07G052590 · TK1151

Cell membrane0.060

Rank 5 · TkA07G052590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_296-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G052590	`PF03141`	Methyltransf_29	6	198	3.2e-54	185.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIZ3`	Arabidopsis thaliana	sp\|Q9SIZ3\|PMTN_ARATH Probable methyltransferase PMT23	60.500%	Swiss-Prot	High
`Q9LYN3`	Arabidopsis thaliana	sp\|Q9LYN3\|PMTM_ARATH Probable methyltransferase PMT22	50.200%	Swiss-Prot	High
`Q9SD39`	Arabidopsis thaliana	sp\|Q9SD39\|PMTR_ARATH Probable methyltransferase PMT27	44.000%	Swiss-Prot	Medium
`Q0WT31`	Arabidopsis thaliana	sp\|Q0WT31\|PMTP_ARATH Probable methyltransferase PMT25	43.800%	Swiss-Prot	Medium
`Q8L7V3`	Arabidopsis thaliana	sp\|Q8L7V3\|PMTQ_ARATH Probable methyltransferase PMT26	43.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card