TkA07G050350 | RubberDandelionOmics

Gene overview

TkA07G050350

Reference: TK1151 Chr: Chr07 Coordinates: 13364797-13373190 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1586 bp · TkA07G050350|TK1151|cDNA

GATTCGTGTGCTGGTCACCTTGTTCTTCAAGGAGAATTCACAAATGCCTTTACAACGATCTTCCAATATCCGTGAACGACGAGGAATCTACACAGATATTCATCATTTCTAGACAACTTAAAATCAAATGTAAGTGCACATAGATTTGATTCAAGCCTCCAAGTGCTTTCGGGTGAAAATGAATTTATCACTTTCAAACGCCCGATCTCGGAATCGCAAAAGATCAACCGAGGTTTTTCCAGATGTAATGAAGGTAAGTG...

CDS

Download CDS FASTA

930 bp · TkA07G050350|TK1151|CDS

ATGGCAAGTGAATTGTTCAATTTACTTAGAAGAGCTCATGAAGATAGATGTCTTCCAGGGTTCAGACTTCTCAATTGGCATTTCTTCTTCACTGCAATGTTGTTTGTATATGGTCGAATTCTCAGCCAACAGATAATGCATGCTGTAAATTCTGATAAATTCTTCTACAAGCTTGCAACCAGTTTTATGAAGTATCAGATGGTTATCTGTTATTTCTTATACATCACAGGGTTCATGTGGTTCATACTTACACTAAAGGC...

Protein

Download Protein FASTA

309 aa · TkA07G050350|TK1151|PROTEIN

MASELFNLLRRAHEDRCLPGFRLLNWHFFFTAMLFVYGRILSQQIMHAVNSDKFFYKLATSFMKYQMVICYFLYITGFMWFILTLKAKMYKYQFSQYAWTHMILIVVFTQSSFTAANIFEGIFCIFLWFFLWENPSYQAFPKKTWEGFLGASVTTVISAFVLANIVGRYQWLTCPRRDLSTSWLECDPGPIFTPELFELPSGLPWKEISVLPVQWHALCLGLFASVIAPFGGFFASGFKRAFNIKDFCGSIPGHGGFTDR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G050350`
TK1151 ID	TkA07G050350
OH-1004 ID	LXL04_027324
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	87.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G050350

Location Chr07:13364797-13373190 (+)

Description Similar to CDS2: Phosphatidate cytidylyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22340`	May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.	Two closely related genes of Arabidopsis encode plastidial cytidinediphosphate diacylglycerol synthases essential for photoautotrophic growth.2010 · DOI: 10.1104/pp.110.156422
`At4g26770`	May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.	No verified direct reference in this release
`At1g62430`	May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027324 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006661 phosphatidylinositol biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0016024 CDP-diacylglycerol biosynthetic process Biological Process

GO:0080186 developmental vegetative growth Biological Process

GO:0140042 lipid droplet formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0004605 phosphatidate cytidylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G62430

ath:AT4G22340

ath:AT4G26770

mmu:74596

sot:102597765

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.759

Rank 1 · TkA07G050350 · TK1151

Nucleus0.121

Rank 2 · TkA07G050350 · TK1151

Golgi apparatus0.100

Rank 3 · TkA07G050350 · TK1151

Cytoplasm0.096

Rank 4 · TkA07G050350 · TK1151

Cell membrane0.059

Rank 5 · TkA07G050350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01148CTP_transf_12-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G050350	`PF01148`	CTP_transf_1	2	268	3.3e-41	142.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49639`	Arabidopsis thaliana	sp\|O49639\|CDS2_ARATH Phosphatidate cytidylyltransferase 2	66.200%	Swiss-Prot	High
`Q1PE48`	Arabidopsis thaliana	sp\|Q1PE48\|CDS3_ARATH Phosphatidate cytidylyltransferase 3	63.600%	Swiss-Prot	High
`O04928`	Arabidopsis thaliana	sp\|O04928\|CDS1_ARATH Phosphatidate cytidylyltransferase 1	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card