TkA07G047870 | RubberDandelionOmics

Gene overview

TkA07G047870

Reference: TK1151 Chr: Chr07 Coordinates: 12721371-12731055 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · TkA07G047870|TK1151|cDNA

ATGATTTCTGAAGCTTTAGGGCTCGATTCAAGATACCTCCAAGAAATTGGTTGTGCAGATGGACTCTTCGATAACGACTTCCTAATTGTGCTCCTACAAGATCATATTGGGGGTCTCCAATTCCTTGACCGGAATCAATGGGTTAATGTTCCCTTCGTTCCCGGAGCACTTGTGGTCAACATCGGAGATCTTCTACAGCTGATATCAAACGATGAGTTCATCAGTACAGAGCACAAAGGCCGATGGGTCCAGAAACAGGG...

CDS

Download CDS FASTA

318 bp · TkA07G047870|TK1151|CDS

ATGATTTCTGAAGCTTTAGGGCTCGATTCAAGATACCTCCAAGAAATTGGTTGTGCAGATGGACTCTTCGATAACGACTTCCTAATTGTGCTCCTACAAGATCATATTGGGGGTCTCCAATTCCTTGACCGGAATCAATGGGTTAATGTTCCCTTCGTTCCCGGAGCACTTGTGGTCAACATCGGAGATCTTCTACAGCTGATATCAAACGATGAGTTCATCAGTACAGAGCACAAAGGCCGATGGGTCCAGAAACAGGG...

Protein

Download Protein FASTA

105 aa · TkA07G047870|TK1151|PROTEIN

MISEALGLDSRYLQEIGCADGLFDNDFLIVLLQDHIGGLQFLDRNQWVNVPFVPGALVVNIGDLLQLISNDEFISTEHKGRWVQKQGSNEIDTPWFAASGYVALV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G047870`
TK1151 ID	TkA07G047870
OH-1004 ID	LXL04_001844
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.200
Protein coverage (%)	TK1151 98.095 / OH-1004 37.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G047870

Location Chr07:12721371-12731055 (+)

Description Similar to At1g06620: 1-aminocyclopropane-1-carboxylate oxidase homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43450`	1-aminocyclopropane-1-carboxylate oxidase homolog 10.	No verified direct reference in this release
`At1g06620`	1-aminocyclopropane-1-carboxylate oxidase homolog 1.	No verified direct reference in this release
`At5g43440`	1-aminocyclopropane-1-carboxylate oxidase homolog 9.	No verified direct reference in this release
`At1g03410`	1-aminocyclopropane-1-carboxylate oxidase homolog 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016629 12-oxophytodienoate reductase activity Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ag:AAB97311

ath:AT1G04350

ath:AT1G06620

ath:AT5G59530

ath:AT5G59540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.467

Rank 1 · TkA07G047870 · TK1151

Nucleus0.143

Rank 2 · TkA07G047870 · TK1151

Peroxisome0.143

Rank 3 · TkA07G047870 · TK1151

Extracellular0.089

Rank 4 · TkA07G047870 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA07G047870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF031712OG-FeII_Oxy23-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G047870	`PF03171`	2OG-FeII_Oxy	23	86	7.2e-16	59.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSW6`	Arabidopsis thaliana	sp\|Q9LSW6\|ACH10_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 10	51.500%	Swiss-Prot	High
`Q84MB3`	Arabidopsis thaliana	sp\|Q84MB3\|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1	49.500%	Swiss-Prot	Medium
`Q9LSW7`	Arabidopsis thaliana	sp\|Q9LSW7\|ACCH9_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 9	41.800%	Swiss-Prot	Medium
`Q43383`	Arabidopsis thaliana	sp\|Q43383\|ACCH5_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 5	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card