TkA07G041320 | RubberDandelionOmics

Gene overview

TkA07G041320

Reference: TK1151 Chr: Chr07 Coordinates: 11071350-11075552 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2337 bp · TkA07G041320|TK1151|cDNA

AAGAAGTTGACATGAATGCATCATCAAATAACAGAACAAGTTTACAGAAATGCTATAATGAACCTCTGTCCATTCTCCCCCTTCTTCTCCATTCCTCCTCCACCATACTCACTGTTACTTCTCCTTCTTTGACCTCACAATGAACCAATATCGCATTTCATCAATAACACCCATAATTTCATTTCGCAATTGTATTCACAAACCTCGAAACCTTTAGATCTGCACAATAATTTCAATGAGGTCACGTCTGTTTCTGTTTC...

CDS

Download CDS FASTA

1017 bp · TkA07G041320|TK1151|CDS

ATGACAAATCCGTCATTGGATGCACGATCATCGAGTGTCGAATGTCTAGGTTCATTGGTGGTAAGACCCTCAAGTAACGGAGGAGTTGTGTTGCAACAACAAATGAATCAACCAATCCCACCCTCTAAGAAATCTTTAAAGATGTTCGTAAATAAAGAGAAGGATCATGCATTCATTTGGATCTTCAAATTCGCACCTCGAAAGAAGATTGGAATGTTGCTCTTGTCTCTTGCTTCCTTCGGAGCTATGTTATGGATACT...

Protein

Download Protein FASTA

338 aa · TkA07G041320|TK1151|PROTEIN

MTNPSLDARSSSVECLGSLVVRPSSNGGVVLQQQMNQPIPPSKKSLKMFVNKEKDHAFIWIFKFAPRKKIGMLLLSLASFGAMLWILYIAKGEFNQQTSTLQFSSSNIDHERVKQFDSALMNDQMKITVTHDDNMLYHHQPPPPPPPPIPPPPPPPPAYFTGYTLPPGKPCEHFTLPPPPADKKKTGPRPCPVCYLPVEEAIALMPKAPSFSPVLQNLTFVHDESFTKSEFGGSDFGGYPTLKQRHDSYDVRESMSVHCG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G041320`
TK1151 ID	TkA07G041320
OH-1004 ID	LXL04_027247
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 95.266 / OH-1004 49.768 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G041320

Location Chr07:11071350-11075552 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28240`	Probable glycosyltransferase involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Identification of Key Enzymes for Pectin Synthesis in Seed Mucilage.2018 · DOI: 10.1104/pp.18.00584

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027247 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009992 intracellular water homeostasis Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010246 rhamnogalacturonan I biosynthetic process Biological Process

GO:0045491 xylan metabolic process Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:0000139 Golgi membrane Cellular Component

KEGG gene cross-reference

ath:AT1G28240

ath:AT5G46220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.669

Rank 1 · TkA07G041320 · TK1151

Endoplasmic reticulum0.143

Rank 2 · TkA07G041320 · TK1151

Cell membrane0.101

Rank 3 · TkA07G041320 · TK1151

Cytoplasm0.088

Rank 4 · TkA07G041320 · TK1151

Nucleus0.073

Rank 5 · TkA07G041320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04765TOD1_MUCI70218-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G041320	`PF04765`	TOD1_MUCI70	218	328	1.2e-33	117.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ97`	Arabidopsis thaliana	sp\|Q9FZ97\|MUC70_ARATH Probable hexosyltransferase MUCI70	47.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card