TkA07G041120 | RubberDandelionOmics

Gene overview

TkA07G041120

Reference: TK1151 Chr: Chr07 Coordinates: 11019838-11026841 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3926 bp · TkA07G041120|TK1151|cDNA

ATTTGTCTCCCTCTTGACATTTCGACTAGCGGAGAGAACCTAAACCCGCTCTCCTTCCTCAATCCAGACTGCGTTCCTTCAAAAAACTTTGATCGAACCTCTCGATTTTGAGCTGGATAAAAGGCTTTCCTAAGGATTTAGGTATGGATTTGGAAGAAGAGTATGATCAAGGATACAACGATGAGGAAGAAGACATAACCCAAGAGGATGCTTGGGCAGTTATCAGTTCTTATTTCGAAGAAAAGGGTCTTGTTCGTCAA...

CDS

Download CDS FASTA

3570 bp · TkA07G041120|TK1151|CDS

ATGGATTTGGAAGAAGAGTATGATCAAGGATACAACGATGAGGAAGAAGACATAACCCAAGAGGATGCTTGGGCAGTTATCAGTTCTTATTTCGAAGAAAAGGGTCTTGTTCGTCAACAACTTGACTCATTTGATGAGTTTATTCAGAATACTATGCAAGAAATTGTGGACGAGTCTGCAGATATTGAGATCCGACCCGAATCCCAGCACAATCCGGGTCACCAGCCTGATTTTGCCGAGACAATCTATAAGATCAGCTT...

Protein

Download Protein FASTA

1189 aa · TkA07G041120|TK1151|PROTEIN

MDLEEEYDQGYNDEEEDITQEDAWAVISSYFEEKGLVRQQLDSFDEFIQNTMQEIVDESADIEIRPESQHNPGHQPDFAETIYKISFGQIYLSKPMMTESDGETATLFPKAARLRNLTYSAPLYVDVSKRAIKKGHDGEEVTETQDFAKVFIGKVPIMLRSSYCTLFQNSEKDLTELGECPYDQGGYFIINGSEKVLIAQEKMSTNHVYVFKKRQPNKFAYVGEVRSMAESQNRPPSTMFVRMLSRTSAKGGSSGQYIRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G041120`
TK1151 ID	TkA07G041120
OH-1004 ID	LXL04_027241
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.733 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G041120

Location Chr07:11019838-11026841 (-)

Description Similar to RPB2: DNA-directed RNA polymerase II subunit RPB2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21710`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027241 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006354 DNA-templated transcription elongation Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0035196 miRNA processing Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005665 RNA polymerase II, core complex Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G21710

bta:538184

ddi:DDB_G0288257

hsa:5431

sly:544278

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA07G041120 · TK1151

Cytoplasm0.074

Rank 2 · TkA07G041120 · TK1151

Cell membrane0.020

Rank 3 · TkA07G041120 · TK1151

Mitochondrion0.014

Rank 4 · TkA07G041120 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA07G041120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04561RNA_pol_Rpb2_211-32 aa

PF04563RNA_pol_Rpb2_135-444 aa

PF04561RNA_pol_Rpb2_2137-172 aa

PF04561RNA_pol_Rpb2_2205-396 aa

PF04565RNA_pol_Rpb2_3469-533 aa

PF04566RNA_pol_Rpb2_4568-629 aa

PF04567RNA_pol_Rpb2_5654-705 aa

PF00562RNA_pol_Rpb2_6712-1082 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G041120	`PF04561`	RNA_pol_Rpb2_2	11	32	5.5e-55	186.7
TkA07G041120	`PF04563`	RNA_pol_Rpb2_1	35	444	2.2e-78	263.2
TkA07G041120	`PF04561`	RNA_pol_Rpb2_2	137	172	5.5e-55	186.7
TkA07G041120	`PF04561`	RNA_pol_Rpb2_2	205	396	5.5e-55	186.7
TkA07G041120	`PF04565`	RNA_pol_Rpb2_3	469	533	4.6e-25	88.3
TkA07G041120	`PF04566`	RNA_pol_Rpb2_4	568	629	1.3e-23	83.6
TkA07G041120	`PF04567`	RNA_pol_Rpb2_5	654	705	4.1e-18	66.7
TkA07G041120	`PF00562`	RNA_pol_Rpb2_6	712	1082	5.9e-141	470.6
TkA07G041120	`PF04560`	RNA_pol_Rpb2_7	1084	1175	1.7e-36	125.2
TkA07G041120	`PF04567`	RNA_pol_Rpb2_5	1092	1109	4.1e-18	66.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P38420`	Arabidopsis thaliana	sp\|P38420\|NRPB2_ARATH DNA-directed RNA polymerase II subunit 2	93.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card