TkA07G040530 | RubberDandelionOmics

Gene overview

TkA07G040530

Reference: TK1151 Chr: Chr07 Coordinates: 10829869-10830239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA07G040530|TK1151|cDNA

TTTCTTCTTATCCGTTTCATTCAATTTGCTGGGTGTTCCTGTGTGTTTGCCACCTCTGTTTCCAATTTGTTTCTTCTATCTTCTTATTTTCTCTTCTTATCTCTTTCTTTTTTAAATATCCTTTGGTATTTGTTGTTTCTTATTCCGATTTCCTTCTTTACTCCTTCCTCTTCTCTATCTTTTGCATTTAGTAAGGTCTTATCCGCTTCATACTGTGTGTTTGTGTTTCCATCTTTTCCAAAGGTTAGGATGTTCCTGTT...

CDS

Download CDS FASTA

303 bp · TkA07G040530|TK1151|CDS

TTTCTTCTTATCCGTTTCATTCAATTTGCTGGGTGTTCCTGTGTGTTTGCCACCTCTGTTTCCAATTTGTTTCTTCTATCTTCTTATTTTCTCTTCTTATCTCTTTCTTTTTTAAATATCCTTTGGTATTTGTTGTTTCTTATTCCGATTTCCTTCTTTACTCCTTCCTCTTCTCTATCTTTTGCATTTAGTAAGGTCTTATCCGCTTCATACTGTGTGTTTGTGTTTCCATCTTTTCCAAAGGTTAGGATGTTCCTGTT...

Protein

Download Protein FASTA

100 aa · TkA07G040530|TK1151|PROTEIN

FLLIRFIQFAGCSCVFATSVSNLFLLSSYFLFLSLSFLNILWYLLFLIPISFFTPSSSLSFAFSKVLSASYCVFVFPSFPKVRMFLLLFLSFIYFKLSLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G040530`
TK1151 ID	TkA07G040530
OH-1004 ID	LXL04_018185
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.900
Protein coverage (%)	TK1151 78.000 / OH-1004 37.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G040530`
Location	Chr07:10829869-10830239 (+)
Description	Similar to FUM2: Fumarate hydratase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018185` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006099 tricarboxylic acid cycle Biological Process GO:0006106 fumarate metabolic process Biological Process GO:0006108 malate metabolic process Biological Process GO:0009631 cold acclimation Biological Process GO:0010109 regulation of photosynthesis Biological Process GO:0042128 nitrate assimilation Biological Process GO:0048868 pollen tube development Biological Process GO:0051262 protein tetramerization Biological Process GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component
KEGG gene cross-reference	ath:AT2G47510 ath:AT5G50950 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.403

Rank 1 · TkA07G040530 · TK1151

Nucleus0.397

Rank 2 · TkA07G040530 · TK1151

Endoplasmic reticulum0.144

Rank 3 · TkA07G040530 · TK1151

Mitochondrion0.090

Rank 4 · TkA07G040530 · TK1151

Cell membrane0.065

Rank 5 · TkA07G040530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11893DUF341318-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G040530	`PF11893`	DUF3413	18	74	0.68	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card