TkA07G038400 | RubberDandelionOmics

Gene overview

TkA07G038400

Reference: TK1151 Chr: Chr07 Coordinates: 10191381-10192933 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1315 bp · TkA07G038400|TK1151|cDNA

GATTAACACAGGACGGCCACCGAATCCCATTGACTTCCCCTTTCTTTCTTGTCTTCTTTCCCTCTTTCTTTCTCTCTATATATATGCAAGCTCTCCCATTTCCATGGACCTACATCTCTCTAGCTATCCTCCTCTCTCTCTCTCTCTCTCTCTCTCATCTTTAAAGCTCTTTTAGTGAACAGCGATATATATATACAGATTTTATAAACATCTTAAACTTGTACACCATGGGAAGGTCACCTTGTTGTGAAAAGAACGGG...

CDS

Download CDS FASTA

1020 bp · TkA07G038400|TK1151|CDS

ATGGGAAGGTCACCTTGTTGTGAAAAGAACGGGTTAAAGAAAGGTCCATGGACAGCTGAAGAAGATCAAAAACTGATTGAATACATTCAGAAGAACGGGTATGGAAACTGGAGAACTCTCCCCAAGAATGCTGGGTTACAGAGGTGCGGAAAGAGTTGCAGGTTAAGATGGACGAATTATCTGAGACCCGATATTAAAAGAGGAAGGTTTTCTTTTGAAGAAGAGGAAACAATTATTCAACTGCATAGTATGTTGGGGAA...

Protein

Download Protein FASTA

339 aa · TkA07G038400|TK1151|PROTEIN

MGRSPCCEKNGLKKGPWTAEEDQKLIEYIQKNGYGNWRTLPKNAGLQRCGKSCRLRWTNYLRPDIKRGRFSFEEEETIIQLHSMLGNKWSAIAARLPGRTDNEIKNYWNTHIRKRLLRMGIDPVTHNPRLDLLDISSILSSSIYNQSHTNLFGIQQPAVNPELLRLAASLLSSQRNQSPNFIQENQFGNIPHQVQDQSHLLQLQNQDHQSLIQEIPSCVPYSGESSQLLEPNVDQLPSSFSHFNPDTCALNDWQSKLDNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G038400`
TK1151 ID	TkA07G038400
OH-1004 ID	LXL04_027181
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G038400

Location Chr07:10191381-10192933 (-)

Description Similar to MYB102: Transcription factor MYB102

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21440`	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).	Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273 The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512
`At4g05100`	Probable transcription factor that may function in salt stress response.	Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis.2015 · DOI: 10.1093/jxb/erv312
`At4g28110`	Transcription factor involved in salt stress response.	AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.2009 · DOI: 10.1104/pp.108.134874 Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis.2012 · DOI: 10.1016/j.bbrc.2012.04.137 AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types.2014 · DOI: 10.1111/tpj.12624
`At1g34670`	Transcription factor that acts as a negative regulator of lateral root (LR) development.	AtMYB93 is a novel negative regulator of lateral root development in Arabidopsis.2014 · DOI: 10.1111/nph.12879
`At3g01140`	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation.	Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.2008 · DOI: 10.1104/pp.108.126979 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027181 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0080090 regulation of primary metabolic process Biological Process

KEGG gene cross-reference

ath:AT1G34670

ath:AT4G05100

ath:AT4G21440

ath:AT4G28110

ath:AT5G15310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.803

Rank 1 · TkA07G038400 · TK1151

Cytoplasm0.343

Rank 2 · TkA07G038400 · TK1151

Mitochondrion0.025

Rank 3 · TkA07G038400 · TK1151

Cell membrane0.020

Rank 4 · TkA07G038400 · TK1151

Lysosome / Vacuole0.016

Rank 5 · TkA07G038400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_713-33 aa

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-76 aa

PF23588HTH_CHD1_Hrp317-43 aa

PF00249Myb_DNA-binding67-111 aa

PF15963Myb_DNA-bind_768-120 aa

PF13921Myb_DNA-bind_671-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G038400	`PF15963`	Myb_DNA-bind_7	13	33	0.013	16.0
TkA07G038400	`PF00249`	Myb_DNA-binding	14	61	1.4e-37	128.2
TkA07G038400	`PF13921`	Myb_DNA-bind_6	17	76	4.7e-23	81.8
TkA07G038400	`PF23588`	HTH_CHD1_Hrp3	17	43	0.01	16.6
TkA07G038400	`PF00249`	Myb_DNA-binding	67	111	1.4e-37	128.2
TkA07G038400	`PF15963`	Myb_DNA-bind_7	68	120	0.013	16.0
TkA07G038400	`PF13921`	Myb_DNA-bind_6	71	114	4.7e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDR8`	Arabidopsis thaliana	sp\|Q9LDR8\|MY102_ARATH Transcription factor MYB102	55.600%	Swiss-Prot	High
`Q9M0Y5`	Arabidopsis thaliana	sp\|Q9M0Y5\|MYB74_ARATH Transcription factor MYB74	54.400%	Swiss-Prot	High
`Q9M0J5`	Arabidopsis thaliana	sp\|Q9M0J5\|MYB41_ARATH Transcription factor MYB41	77.100%	Swiss-Prot	Medium
`Q9S9Z2`	Arabidopsis thaliana	sp\|Q9S9Z2\|MYB93_ARATH Transcription factor MYB93	78.000%	Swiss-Prot	Low
`Q9LE63`	Arabidopsis thaliana	sp\|Q9LE63\|MY106_ARATH Transcription factor MYB106	69.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card