TkA07G038050 | RubberDandelionOmics

Gene overview

TkA07G038050

Reference: TK1151 Chr: Chr07 Coordinates: 10087004-10093706 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4010 bp · TkA07G038050|TK1151|cDNA

TTGGACCTTTAGACAGTTTTTCACAGTCTAATGCACATACCGAAAAGATTACAAGCGGAACCTTTTTTTGCCCCTTTCCCCCTCTCGCTAAACATACCCTCTTTCCCCAAAAACCCTTGCTCCGTTACCCTCAAAACCCACATAATTCTTGAAAAAAAGTCGATCTTTCCTCCGTTTTCTTGAAAAAATTTGTGATTCTTCTTTCGTTTTAGCAAAACCCACAAAGAAGAGTGTAAAATGAAGGAAAATGGCGGTGGTGG...

CDS

Download CDS FASTA

2988 bp · TkA07G038050|TK1151|CDS

ATGAAGGAAAATGGCGGTGGTGGCGGTGGTTCTCTGCCAGACGAGCAGAGGTGTAAAAGGAGCGATGGCAGGAAGTGGCGGTGCGGTCGGCCGGTGATGGAGGGAAGGACTCTTTGTGAAACGCATTTTCTTCAAGGTCGTCACCGGCAACACAAGGAGCCGGTTCCCGACAATTTAAAGATCGAGAGGCAAAGAACCACCAGAAAGGTCGAGGAAAAAAACCCTACTGAGAACAGTGAAATTAGGGCTAACGGGAATGC...

Protein

Download Protein FASTA

995 aa · TkA07G038050|TK1151|PROTEIN

MKENGGGGGGSLPDEQRCKRSDGRKWRCGRPVMEGRTLCETHFLQGRHRQHKEPVPDNLKIERQRTTRKVEEKNPTENSEIRANGNAGSSNLPRKKGKRKLFDEERAAGSSNLHRKLRKRNQKEGKSKSSMDISEDLDDALKKMNLKKGDLQLDLIRGYLNRQIEKKKGKQPQNEDIVKEDIVKELKYGRLEISQSSPSSTPITVNNAAFVNGKIGVSPSSSMPTRFFRSKNIDRVPIATMQVLPSIKANVKAATKKCHW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G038050`
TK1151 ID	TkA07G038050
OH-1004 ID	LXL04_027178
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G038050

Location Chr07:10087004-10093706 (+)

Description Similar to JMJ25: Lysine-specific demethylase JMJ25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21430`	May function as histone H3 lysine demethylase and be involved in regulation of gene expression (By similarity).	The Arabidopsis histone demethylase JMJ28 regulates CONSTANS by interacting with FBH transcription factors.2021 · DOI: 10.1093/plcell/koab014
`At1g62310`	May function as histone H3 lysine demethylase and be involved in regulation of gene expression.	No verified direct reference in this release
`At1g11950`	May function as histone H3 lysine demethylase and be involved in regulation of gene expression.	No verified direct reference in this release
`At4g00990`	Histone demethylase that demethylates 'Lys-9' (H3K9me) of histone H3 with a specific activity for H3K9me1 and H3K9me2.	JMJ27, an Arabidopsis H3K9 histone demethylase, modulates defense against Pseudomonas syringae and flowering time.2017 · DOI: 10.1111/tpj.13623 JMJ27-mediated histone H3K9 demethylation positively regulates drought-stress responses in Arabidopsis.2021 · DOI: 10.1111/nph.17593
`At1g09060`	May bind histone H3 but appears to lack demethylase activity because it cannot bind Fe²⁺.	JMJ24 binds to RDR2 and is required for the basal level transcription of silenced loci in Arabidopsis.2015 · DOI: 10.1111/tpj.12924 JMJ24 targets CHROMOMETHYLASE3 for proteasomal degradation in Arabidopsis.2016 · DOI: 10.1101/gad.274647.115 A JUMONJI Protein with E3 Ligase and Histone H3 Binding Activities Affects Transposon Silencing in Arabidopsis.2016 · DOI: 10.1104/pp.15.01688

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027178 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:2000039 regulation of trichome morphogenesis Biological Process

GO:0000118 histone deacetylase complex Cellular Component

KEGG gene cross-reference

ath:AT1G11950

ath:AT1G62310

ath:AT4G00990

ath:AT4G21430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.899

Rank 1 · TkA07G038050 · TK1151

Cytoplasm0.124

Rank 2 · TkA07G038050 · TK1151

Cell membrane0.052

Rank 3 · TkA07G038050 · TK1151

Endoplasmic reticulum0.028

Rank 4 · TkA07G038050 · TK1151

Plastid0.016

Rank 5 · TkA07G038050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08879WRC13-53 aa

PF10497zf-4CXXC_R1254-326 aa

PF10497zf-4CXXC_R1387-424 aa

PF07735FBA_2501-515 aa

PF10497zf-4CXXC_R1506-518 aa

PF07735FBA_2528-556 aa

PF10497zf-4CXXC_R1590-610 aa

PF02373JmjC837-934 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G038050	`PF08879`	WRC	13	53	7.2e-17	61.5
TkA07G038050	`PF10497`	zf-4CXXC_R1	254	326	9.1e-05	23.3
TkA07G038050	`PF10497`	zf-4CXXC_R1	387	424	9.1e-05	23.3
TkA07G038050	`PF07735`	FBA_2	501	515	0.19	12.5
TkA07G038050	`PF10497`	zf-4CXXC_R1	506	518	9.1e-05	23.3
TkA07G038050	`PF07735`	FBA_2	528	556	0.19	12.5
TkA07G038050	`PF10497`	zf-4CXXC_R1	590	610	9.1e-05	23.3
TkA07G038050	`PF02373`	JmjC	837	934	8.6e-10	39.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1S7`	Arabidopsis thaliana	sp\|Q8H1S7\|JMJ28_ARATH Lysine-specific demethylase JMJ28	34.100%	Swiss-Prot	Medium
`C0SV12`	Arabidopsis thaliana	sp\|C0SV12\|JMJ29_ARATH Lysine-specific demethylase JMJ29	33.100%	Swiss-Prot	Medium
`C0SUU8`	Arabidopsis thaliana	sp\|C0SUU8\|JMJ26_ARATH Lysine-specific demethylase JMJ26	32.100%	Swiss-Prot	Medium
`Q8VYB9`	Arabidopsis thaliana	sp\|Q8VYB9\|JMJ27_ARATH Lysine-specific demethylase JMJ27	32.400%	Swiss-Prot	Medium
`F4HZD1`	Arabidopsis thaliana	sp\|F4HZD1\|JMJ24_ARATH E3 ubiquitin-protein ligase JMJ24	26.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card