TkA07G036750 | RubberDandelionOmics

Gene overview

TkA07G036750

Reference: TK1151 Chr: Chr07 Coordinates: 9787935-9788501 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

567 bp · TkA07G036750|TK1151|cDNA

CAATTCCGGCCGAAGAACCAGCAAGCATGGGAGTTCCGAGATGGGTCGGAAGGGTGTGTTCGGAGCTCAAAATTGGATTGTGGGTCGGATGGATTTTTGCCGATGAGGAACATGAAATTGCCGGATAGTTCGAAGGCGGTTGTAGATCGGAAGATGAATTTGAGTGAGTGTGGTGAGATGTGCAAAAAGAAATGTTCTTGTAATGCTTATGCTAGTATGGATGTGAGTGAAGGCGGGTCGGGTTGTGTGATTTGGGAAAC...

CDS

Download CDS FASTA

567 bp · TkA07G036750|TK1151|CDS

CAATTCCGGCCGAAGAACCAGCAAGCATGGGAGTTCCGAGATGGGTCGGAAGGGTGTGTTCGGAGCTCAAAATTGGATTGTGGGTCGGATGGATTTTTGCCGATGAGGAACATGAAATTGCCGGATAGTTCGAAGGCGGTTGTAGATCGGAAGATGAATTTGAGTGAGTGTGGTGAGATGTGCAAAAAGAAATGTTCTTGTAATGCTTATGCTAGTATGGATGTGAGTGAAGGCGGGTCGGGTTGTGTGATTTGGGAAAC...

Protein

Download Protein FASTA

188 aa · TkA07G036750|TK1151|PROTEIN

QFRPKNQQAWEFRDGSEGCVRSSKLDCGSDGFLPMRNMKLPDSSKAVVDRKMNLSECGEMCKKKCSCNAYASMDVSEGGSGCVIWETDLVDMRRYGDSEDGGQDVYVRVAAADLGMFLTRMWKMIIYALKHVTCTCYYTFEQNFRKKEKCFTIFIISTTFYPKKNSKSMIQSLPKNSKSWGFDPGFSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G036750`
TK1151 ID	TkA07G036750
OH-1004 ID	LXL04_027168
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.000
Protein coverage (%)	TK1151 60.106 / OH-1004 13.201 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G036750

Location Chr07:9787935-9788501 (-)

Description Similar to SD18: Receptor-like serine/threonine-protein kinase SD1-8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65790`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027168 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0060320 rejection of self pollen Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G65790

ath:AT1G65800

ath:AT4G21380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.381

Rank 1 · TkA07G036750 · TK1151

Extracellular0.377

Rank 2 · TkA07G036750 · TK1151

Endoplasmic reticulum0.145

Rank 3 · TkA07G036750 · TK1151

Cytoplasm0.113

Rank 4 · TkA07G036750 · TK1151

Nucleus0.072

Rank 5 · TkA07G036750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08276PAN_227-92 aa

PF10530Toxin_3562-83 aa

PF08276PAN_2130-151 aa

PF10530Toxin_35132-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G036750	`PF08276`	PAN_2	27	92	1e-23	83.9
TkA07G036750	`PF10530`	Toxin_35	62	83	0.14	12.9
TkA07G036750	`PF08276`	PAN_2	130	151	1e-23	83.9
TkA07G036750	`PF10530`	Toxin_35	132	151	0.14	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39086`	Arabidopsis thaliana	sp\|Q39086\|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7	51.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card