TkA07G036140 | RubberDandelionOmics

Gene overview

TkA07G036140

Reference: TK1151 Chr: Chr07 Coordinates: 9637085-9639725 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1946 bp · TkA07G036140|TK1151|cDNA

AGGACTTACTTTCCTTCCAAGTGTTTAATTGTACACCTGAAAAACGAGAGAGAAATATTGGTGGAAAACTCTACATGGCAGAAGAATTTCAGGGGGAGGTATGCGGCGGAAGCTGGTGGAGTTCACCAAGAACCACCACGTTCATCGGCTCATCATATATGAGCAACTATGGAGGCTGCTTGCAAAGTGATGTAATAAACATGAAAACAAGGTCAACTGATGAGTCTTCAGATGATTGCACCACCACTATCTCGCCGGAT...

CDS

Download CDS FASTA

1197 bp · TkA07G036140|TK1151|CDS

ATGGCAGAAGAATTTCAGGGGGAGGTATGCGGCGGAAGCTGGTGGAGTTCACCAAGAACCACCACGTTCATCGGCTCATCATATATGAGCAACTATGGAGGCTGCTTGCAAAGTGATGTAATAAACATGAAAACAAGGTCAACTGATGAGTCTTCAGATGATTGCACCACCACTATCTCGCCGGATTCAGCCTTTCAGATGATGGGTTCTTCGCCACCGTCTACAACCACCAATTGGAATCATCAAGCTTTATTAGTTAA...

Protein

Download Protein FASTA

398 aa · TkA07G036140|TK1151|PROTEIN

MAEEFQGEVCGGSWWSSPRTTTFIGSSYMSNYGGCLQSDVINMKTRSTDESSDDCTTTISPDSAFQMMGSSPPSTTTNWNHQALLVNGRTQESNYSQTLPEIMNNLLPGGQDSSNYGMEQQQPSNFLTNSGNNSNGNLNGTSYGYPSSLLQTLLTSTSPPPSQPAAPPQQPFYDFQANLNDFNSVSSIPRFSSSIKPKAPGGLHLANKTPFWNASTLDLNHNRAGFFNSTQSPFLSSTYEDKPSYHNSKLHNEEIRDLGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G036140`
TK1151 ID	TkA07G036140
OH-1004 ID	LXL04_027162
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G036140

Location Chr07:9637085-9639725 (+)

Description Similar to BHLH112: Transcription factor bHLH112

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61660`	Transcription factor bHLH112.	No verified direct reference in this release
`At3g20640`	Transcription factor bHLH123.	No verified direct reference in this release
`At4g21340`	Transcription factor bHLH103.	No verified direct reference in this release
`At4g05170`	Transcription factor bHLH114.	No verified direct reference in this release
`At2g20100`	Transcription factor bHLH133.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027162 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:2000214 regulation of L-proline metabolic process Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT1G61660

ath:AT3G19500

ath:AT3G20640

ath:AT4G05170

ath:AT4G21340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.980

Rank 1 · TkA07G036140 · TK1151

Cytoplasm0.080

Rank 2 · TkA07G036140 · TK1151

Cell membrane0.026

Rank 3 · TkA07G036140 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA07G036140 · TK1151

Plastid0.012

Rank 5 · TkA07G036140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04281Tom22284-323 aa

PF23177bHLH_IRO3286-334 aa

PF23173bHLH_SAC51287-329 aa

PF00010HLH292-325 aa

PF04281Tom22344-360 aa

PF27761VUP_C363-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G036140	`PF04281`	Tom22	284	323	0.076	13.6
TkA07G036140	`PF23177`	bHLH_IRO3	286	334	0.0043	18.1
TkA07G036140	`PF23173`	bHLH_SAC51	287	329	0.0017	19.0
TkA07G036140	`PF00010`	HLH	292	325	0.022	15.3
TkA07G036140	`PF04281`	Tom22	344	360	0.076	13.6
TkA07G036140	`PF27761`	VUP_C	363	375	0.017	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JL3`	Arabidopsis thaliana	sp\|Q94JL3\|BH112_ARATH Transcription factor bHLH112	34.900%	Swiss-Prot	Medium
`Q8GXT3`	Arabidopsis thaliana	sp\|Q8GXT3\|BH123_ARATH Transcription factor bHLH123	44.600%	Swiss-Prot	Medium
`Q8VZ22`	Arabidopsis thaliana	sp\|Q8VZ22\|BH103_ARATH Transcription factor bHLH103	60.200%	Swiss-Prot	Low
`Q9M0X8`	Arabidopsis thaliana	sp\|Q9M0X8\|BH114_ARATH Transcription factor bHLH114	56.800%	Swiss-Prot	Low
`Q7XHI5`	Arabidopsis thaliana	sp\|Q7XHI5\|BH133_ARATH Transcription factor bHLH133	42.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card