TkA07G035750 | RubberDandelionOmics

Gene overview

TkA07G035750

Reference: TK1151 Chr: Chr07 Coordinates: 9523146-9526329 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

864 bp · TkA07G035750|TK1151|CDS

ATGGCGACTTACAGATGGAAGAGCTTCGTCGAAGACCAAGACCGCCCGGAAAAACCTCGAAGATTCGGTGTAACGGAGATCCGTGGCCCAAACCACACATCCCTGTTCTCTCAAAACTTACTTCAGGACATGTTGGAGTCTGTGGGACAGTTTGTTGATGGTTTGAAGTTCACAGGAGGCTCTGAAAGCTTAATGCCAAAATCCTTCATCAAAGAAGCAACGAAATTAGCACACAAACATGATATATACGTTAGTACAGG...

Protein

Download Protein FASTA

287 aa · TkA07G035750|TK1151|PROTEIN

MATYRWKSFVEDQDRPEKPRRFGVTEIRGPNHTSLFSQNLLQDMLESVGQFVDGLKFTGGSESLMPKSFIKEATKLAHKHDIYVSTGDWAEYLLQKGSSSFKEYIQECKQLGFDTVELNMSLLDLPEETLLRYIRLIKSEGLKVKPQFAVKFNKAEIPPIRARAYGAYVVPSPPTSERVEDVDFLIRRAERCLEAGADMITIDAEDVCKYVDSVRSDIIAKVIGRLGLQNTMFETSNAKTSEWFIKQYGPNVNLFIDHSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G035750`
TK1151 ID	TkA07G035750
OH-1004 ID	LXL04_027154
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G035750

Location Chr07:9523146-9526329 (+)

Description Similar to HSA32: Protein HEAT-STRESS-ASSOCIATED 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21320`	Transactivator required, together with HSP101, for long-term acquired thermotolerance (LAT) maintenance, probably by regulating heat-inducible genes expression, thus being a cellular component of thermomemory.	Arabidopsis Hsa32, a novel heat shock protein, is essential for acquired thermotolerance during long recovery after acclimation.2006 · DOI: 10.1104/pp.105.074898 A heat-inducible transcription factor, HsfA2, is required for extension of acquired thermotolerance in Arabidopsis.2007 · DOI: 10.1104/pp.106.091322

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027154 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0010286 heat acclimation Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:0019295 coenzyme M biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0043817 phosphosulfolactate synthase activity Molecular Function

GO:0050545 sulfopyruvate decarboxylase activity Molecular Function

KEGG gene cross-reference

ath:AT4G21320

mja:MJ_0255

mth:MTH_1674

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkA07G035750 · TK1151

Nucleus0.268

Rank 2 · TkA07G035750 · TK1151

Plastid0.097

Rank 3 · TkA07G035750 · TK1151

Peroxisome0.091

Rank 4 · TkA07G035750 · TK1151

Mitochondrion0.066

Rank 5 · TkA07G035750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02679ComA14-271 aa

PF14091DUF426992-115 aa

PF01261AP_endonuc_2105-202 aa

PF14091DUF4269105-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G035750	`PF02679`	ComA	14	271	1e-73	248.5
TkA07G035750	`PF14091`	DUF4269	92	115	0.13	13.2
TkA07G035750	`PF01261`	AP_endonuc_2	105	202	0.0019	18.6
TkA07G035750	`PF14091`	DUF4269	105	152	0.13	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWL1`	Arabidopsis thaliana	sp\|Q8GWL1\|HSA32_ARATH Protein HEAT-STRESS-ASSOCIATED 32	70.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card