TkA07G034770 | RubberDandelionOmics

Gene overview

TkA07G034770

Reference: TK1151 Chr: Chr07 Coordinates: 9278729-9282714 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1352 bp · TkA07G034770|TK1151|cDNA

ATGCGCTTCTTTTATAACCACCTAAGCTACAAAGTGAATAAAATAATTAGAAAAATAAATTAAAAAAGAAAATGATATCTTCTTCAACCTTCACCTTATCCAATCTTCCGCCAAAATCATCACCGCTGATTGCTGGACCTACACCTGAACCTAAGCATACGAGCCACCGTCCACCGGAATCTGACCGCCATAAGCTCAACAAAGGTAGCTCTCAGTTGAACCGATGGTCTCGAGCTCGCGCAATCCGATCTGGCTTGAAA...

CDS

Download CDS FASTA

1221 bp · TkA07G034770|TK1151|CDS

ATGATATCTTCTTCAACCTTCACCTTATCCAATCTTCCGCCAAAATCATCACCGCTGATTGCTGGACCTACACCTGAACCTAAGCATACGAGCCACCGTCCACCGGAATCTGACCGCCATAAGCTCAACAAAGGTAGCTCTCAGTTGAACCGATGGTCTCGAGCTCGCGCAATCCGATCTGGCTTGAAACTAGACCGACCAGCTCAACGAACACTGCTGCAGAACACGGAGGTTGTTGATCCACCGGTGCGGCGCTCTGG...

Protein

Download Protein FASTA

406 aa · TkA07G034770|TK1151|PROTEIN

MISSSTFTLSNLPPKSSPLIAGPTPEPKHTSHRPPESDRHKLNKGSSQLNRWSRARAIRSGLKLDRPAQRTLLQNTEVVDPPVRRSGDGLSVSNPNYSSEDEDGCIAEMEAAASGAKHIYMVSDGTGWTAEHSVTAALGQFEHCLVDRGCPVNTHLFSGIEDVEQLMEIIKQAAREEAMLIYTLADENMAASARHACKRWGVASTDILSPITDAIALHLGVSPSGLPRGAPGRKFPLTEDYFKRIDAIEFTIKQDDGALP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G034770`
TK1151 ID	TkA07G034770
OH-1004 ID	LXL04_034687
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.500
Protein coverage (%)	TK1151 93.842 / OH-1004 92.214 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G034770

Location Chr07:9278729-9282714 (+)

Description Similar to PDRP1: Probable pyruvate, phosphate dikinase regulatory protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21210`	Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation.	No verified direct reference in this release
`At3g01200`	Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YM35`	Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation.	No verified direct reference in this release
`Os07g0530600`	Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034687 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016776 phosphotransferase activity, phosphate group as acceptor Molecular Function

KEGG gene cross-reference

ath:AT3G01200

ath:AT4G21210

dosa:Os07g0530600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.943

Rank 1 · TkA07G034770 · TK1151

Mitochondrion0.071

Rank 2 · TkA07G034770 · TK1151

Cytoplasm0.040

Rank 3 · TkA07G034770 · TK1151

Nucleus0.034

Rank 4 · TkA07G034770 · TK1151

Peroxisome0.020

Rank 5 · TkA07G034770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03618Kinase-PPPase119-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G034770	`PF03618`	Kinase-PPPase	119	387	1e-85	288.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49562`	Arabidopsis thaliana	sp\|O49562\|PDRP1_ARATH Pyruvate, phosphate dikinase regulatory protein 1, chloroplastic	62.600%	Swiss-Prot	High
`Q9MAC9`	Arabidopsis thaliana	sp\|Q9MAC9\|PDRP2_ARATH Pyruvate, phosphate dikinase regulatory protein 2	58.600%	Swiss-Prot	High
`A2YM35`	Oryza sativa subsp. indica	sp\|A2YM35\|PDRP1_ORYSI Probable pyruvate, phosphate dikinase regulatory protein, chloroplastic	65.300%	Swiss-Prot	High
`Q8GVP6`	Oryza sativa subsp. japonica	sp\|Q8GVP6\|PDRP1_ORYSJ Probable pyruvate, phosphate dikinase regulatory protein, chloroplastic	65.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card