TkA07G034110 | RubberDandelionOmics

Gene overview

TkA07G034110

Reference: TK1151 Chr: Chr07 Coordinates: 9121653-9124539 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2760 bp · TkA07G034110|TK1151|cDNA

ATGGAGAGCGGCGAGGAAGGATGGAAGCAGGTATCAAGAGGGAAGAAGAACAATGGAGAATCCTGGGCTAACAGAGTCAAAGTAGCGGCGACGGAAAGGAATCCCGGTGCCTCACCCCTTAAATCGGATGATATTGGAGGGAAAGCAATCTCGTTCTACATCACAAACTTCCCAGAGGTGTGGAAAGAAGATGATATATGGAAGGCTCTCCAAGAAGCGGGAAAGATCGTAGACTTATTCATCGCCAGGAAGAGGAATGC...

CDS

Download CDS FASTA

2760 bp · TkA07G034110|TK1151|CDS

ATGGAGAGCGGCGAGGAAGGATGGAAGCAGGTATCAAGAGGGAAGAAGAACAATGGAGAATCCTGGGCTAACAGAGTCAAAGTAGCGGCGACGGAAAGGAATCCCGGTGCCTCACCCCTTAAATCGGATGATATTGGAGGGAAAGCAATCTCGTTCTACATCACAAACTTCCCAGAGGTGTGGAAAGAAGATGATATATGGAAGGCTCTCCAAGAAGCGGGAAAGATCGTAGACTTATTCATCGCCAGGAAGAGGAATGC...

Protein

Download Protein FASTA

919 aa · TkA07G034110|TK1151|PROTEIN

MESGEEGWKQVSRGKKNNGESWANRVKVAATERNPGASPLKSDDIGGKAISFYITNFPEVWKEDDIWKALQEAGKIVDLFIARKRNAAGRKFGFARFYGVKDSKKCEELLNNIWMKKLKLKANIARFGRKERREERRNITKGNTNSPDATDRLKNVAITGSGAYADKLKGKNASNRCKEQSRSEGGRDTSSGDDIQAICVTLPSSKTEELGRCLIARFKDYSHLLNFQSSMAEEGWSDIKCRYIGGLYSILEFRSNQATQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G034110`
TK1151 ID	TkA07G034110
OH-1004 ID	LXL04_008804
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.500
Protein coverage (%)	TK1151 43.852 / OH-1004 35.386 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G034110`
Location	Chr07:9121653-9124539 (-)
Description	Similar to GLOX1: Aldehyde oxidase GLOX1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008804` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0050665 hydrogen peroxide biosynthetic process Biological Process GO:0050832 defense response to fungus Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005737 cytoplasm Cellular Component GO:0004031 aldehyde oxidase activity Molecular Function
KEGG gene cross-reference	abe:ARB_07867 ag:AAA33747 ath:AT1G67290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.452

Rank 1 · TkA07G034110 · TK1151

Nucleus0.448

Rank 2 · TkA07G034110 · TK1151

Cell membrane0.150

Rank 3 · TkA07G034110 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA07G034110 · TK1151

Golgi apparatus0.025

Rank 5 · TkA07G034110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_153-119 aa

PF14529Exo_endo_phos_2511-545 aa

PF14529Exo_endo_phos_2552-599 aa

PF14529Exo_endo_phos_2840-879 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G034110	`PF00076`	RRM_1	53	119	1.4e-05	25.6
TkA07G034110	`PF14529`	Exo_endo_phos_2	511	545	0.3	11.7
TkA07G034110	`PF14529`	Exo_endo_phos_2	552	599	0.3	11.7
TkA07G034110	`PF14529`	Exo_endo_phos_2	840	879	0.3	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card