TkA07G033770 | RubberDandelionOmics

Gene overview

TkA07G033770

Reference: TK1151 Chr: Chr07 Coordinates: 9014212-9020307 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2955 bp · TkA07G033770|TK1151|cDNA

CTGAAAATACAAATTATTTGTTTTACCAAGATGCACGCATCGACCCCTCTCGTCCCCCCTGCAACTGCAGTTTCCCCTCCCAAAAGGCTCCCTCTCCTCCAAACGAAATGCTTTAAGCCATGAACTCCAGCTCTCAAACCTTCATCAAAACCCTAACCTTAACCCTGACCCTAACCCTAACCCTAATTCAACACACCATTCAAACAATATCCATTTGAGCGCCAAAAAACCCAATCCGAAATGGAGGGTGCGAGTTTTAT...

CDS

Download CDS FASTA

1914 bp · TkA07G033770|TK1151|CDS

ATGCGCCATCTTTTTGGCACATGGTCAACAGTATTCCCATCTTCTGTTCTTAGAAAGATTGAATCTCAATTACAGTTTTCCCCTTCTCCAAGTTACCAATCATCTGGTTTAAAAGATGCTGAGTCACCAAAACCAGCTCATGGCATACATGTCAATCCAAAGTATTTGGAGGCAAGACGCCAACTTGAAACATCATCTACAGACACCAAACTTCAACACACAAGACCAGTTCCAACTCAAAAGATTCTTGGACAGGTGTC...

Protein

Download Protein FASTA

637 aa · TkA07G033770|TK1151|PROTEIN

MRHLFGTWSTVFPSSVLRKIESQLQFSPSPSYQSSGLKDAESPKPAHGIHVNPKYLEARRQLETSSTDTKLQHTRPVPTQKILGQVSAVFDEYETDNGKSNSQTGGQTSFGVEEFSVGIDSPKRTVESASPSSHHGYGYRPSNGFDVQRPRALISAYGTDERNRMNVQHGKNLSVNGLGSKGGVMTWQNAEEEEFEWENMSPTLAGSSKMGHVIGPNRTLQSDRGLKRKMNVFQNEPSDNPVSRYSQEPLNLPHEQPWAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G033770`
TK1151 ID	TkA07G033770
OH-1004 ID	LXL04_014900
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	26.800
Protein coverage (%)	TK1151 97.802 / OH-1004 71.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G033770

Location Chr07:9014212-9020307 (+)

Description Similar to PCFS4: Polyadenylation and cleavage factor homolog 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04885`	Promotes flowering by suppressing FLC-mediated inhibition of flowering through the regulation of FCA pre-mRNA alternative processing.	Arabidopsis PCFS4, a homologue of yeast polyadenylation factor Pcf11p, regulates FCA alternative processing and promotes flowering time.2008 · DOI: 10.1111/j.1365-313x.2008.03455.x Ratio-based analysis of differential mRNA processing and expression of a polyadenylation factor mutant pcfs4 using arabidopsis tiling microarray.2011 · DOI: 10.1371/journal.pone.0014719
`At1g66500`	Polyadenylation and cleavage factor homolog 1.	No verified direct reference in this release
`At5g43620`	Polyadenylation and cleavage factor homolog 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014900 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006369 termination of RNA polymerase II transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009908 flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0031440 regulation of mRNA 3'-end processing Biological Process

GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005849 mRNA cleavage factor complex Cellular Component

GO:0000993 RNA polymerase II complex binding Molecular Function

KEGG gene cross-reference

ath:AT1G66500

ath:AT4G04885

ath:AT5G43620

hsa:51585

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.856

Rank 1 · TkA07G033770 · TK1151

Cytoplasm0.213

Rank 2 · TkA07G033770 · TK1151

Cell membrane0.038

Rank 3 · TkA07G033770 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA07G033770 · TK1151

Golgi apparatus0.018

Rank 5 · TkA07G033770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27618Zn_ribbon_GTF2H2474-494 aa

PF24461DUF7576476-492 aa

PF18439zf_UBZ477-499 aa

PF13894zf-C2H2_4477-498 aa

PF00096zf-C2H2477-498 aa

PF24461DUF7576550-573 aa

PF23228zf_PCFS4552-618 aa

PF21936Pcf11_C555-593 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G033770	`PF27618`	Zn_ribbon_GTF2H2	474	494	0.22	11.9
TkA07G033770	`PF24461`	DUF7576	476	492	1.8	9.2
TkA07G033770	`PF18439`	zf_UBZ	477	499	0.01	16.2
TkA07G033770	`PF13894`	zf-C2H2_4	477	498	0.16	13.5
TkA07G033770	`PF00096`	zf-C2H2	477	498	0.74	11.1
TkA07G033770	`PF24461`	DUF7576	550	573	1.8	9.2
TkA07G033770	`PF23228`	zf_PCFS4	552	618	6.6e-27	93.7
TkA07G033770	`PF21936`	Pcf11_C	555	593	0.0034	18.0
TkA07G033770	`PF27618`	Zn_ribbon_GTF2H2	560	569	0.22	11.9
TkA07G033770	`PF18439`	zf_UBZ	562	573	0.01	16.2
TkA07G033770	`PF13894`	zf-C2H2_4	565	575	0.16	13.5
TkA07G033770	`PF00096`	zf-C2H2	565	574	0.74	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPF2`	Arabidopsis thaliana	sp\|Q0WPF2\|PCFS4_ARATH Polyadenylation and cleavage factor homolog 4	38.700%	Swiss-Prot	Medium
`Q9C710`	Arabidopsis thaliana	sp\|Q9C710\|PCFS1_ARATH Polyadenylation and cleavage factor homolog 1	44.100%	Swiss-Prot	Low
`Q9FIX8`	Arabidopsis thaliana	sp\|Q9FIX8\|PCFS5_ARATH Polyadenylation and cleavage factor homolog 5	45.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card