TkA07G031900 | RubberDandelionOmics

Gene overview

TkA07G031900

Reference: TK1151 Chr: Chr07 Coordinates: 8501593-8503738 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1091 bp · TkA07G031900|TK1151|cDNA

CGTTGTGCATATCTGCTTATAAGTTTCTCTCTCTAAAGTTCCCAGATCCGTCTGTTTCTCTCTCTAGATTCATCGAGTTCTGTTTACAAAAGATCGCTGATTGTCGAGATTGGAAGTATTCGAAGCTTGGTTTAGTGTTTTCTTGAAGAAACTAGGTTAAAAATGGCGCAAGCTGTGGAGGATTGGTACAAACAGATGCCTATTATCACTCGTTCGTATCTCACAGCTGCAATTGTTACCACAATCGGTTGCTCGCTTGA...

CDS

Download CDS FASTA

732 bp · TkA07G031900|TK1151|CDS

ATGGCGCAAGCTGTGGAGGATTGGTACAAACAGATGCCTATTATCACTCGTTCGTATCTCACAGCTGCAATTGTTACCACAATCGGTTGCTCGCTTGAGATCATTTCACCGTACAACTTATACCTAAATCCCAGACTTGTGGTTAAGCAATATCAAATCTGGCGATTGATCACCAATTTTCTCTATTTCCGAAAGATGGATTTGGACTTTCTGTTTCACATGTTCTTTCTGGCTCGATACTGCAAACTTCTAGAAGAAAA...

Protein

Download Protein FASTA

243 aa · TkA07G031900|TK1151|PROTEIN

MAQAVEDWYKQMPIITRSYLTAAIVTTIGCSLEIISPYNLYLNPRLVVKQYQIWRLITNFLYFRKMDLDFLFHMFFLARYCKLLEENSFRGKTADFFYMLLFGATVLTTIVLVGGMIPYVSESFAKIIFLSNSLTFMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVLVGASAWVDLLGMIAGHAYYFLEDVYPKMTGRRPLKTPTFIKQLFADEAVVVARPAEVRFAAPPLEEMRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G031900`
TK1151 ID	TkA07G031900
OH-1004 ID	LXL04_027095
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G031900

Location Chr07:8501593-8503738 (+)

Description Similar to DER2.2: Derlin-2.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04860`	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	No verified direct reference in this release
`At4g21810`	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0852200`	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027095 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005047 signal recognition particle binding Molecular Function

KEGG gene cross-reference

ath:AT4G04860

ath:AT4G21810

dosa:Os03g0852200

zma:606471

zma:606472

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.885

Rank 1 · TkA07G031900 · TK1151

Golgi apparatus0.079

Rank 2 · TkA07G031900 · TK1151

Nucleus0.072

Rank 3 · TkA07G031900 · TK1151

Cytoplasm0.069

Rank 4 · TkA07G031900 · TK1151

Cell membrane0.035

Rank 5 · TkA07G031900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04511DER112-211 aa

PF13965SID-1_RNA_chan57-180 aa

PF15831SMIM5_18_2293-113 aa

PF09583Phageshock_PspG96-142 aa

PF15831SMIM5_18_22146-172 aa

PF09583Phageshock_PspG150-172 aa

PF07048DUF1331198-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G031900	`PF04511`	DER1	12	211	2.2e-63	214.4
TkA07G031900	`PF13965`	SID-1_RNA_chan	57	180	0.96	8.6
TkA07G031900	`PF15831`	SMIM5_18_22	93	113	6.2	8.0
TkA07G031900	`PF09583`	Phageshock_PspG	96	142	9.0	7.4
TkA07G031900	`PF15831`	SMIM5_18_22	146	172	6.2	8.0
TkA07G031900	`PF09583`	Phageshock_PspG	150	172	9.0	7.4
TkA07G031900	`PF07048`	DUF1331	198	216	0.038	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZS88`	Arabidopsis thaliana	sp\|Q9ZS88\|DER22_ARATH Derlin-2.2	86.400%	Swiss-Prot	High
`Q8VZ96`	Arabidopsis thaliana	sp\|Q8VZ96\|DER21_ARATH Derlin-2.1	86.000%	Swiss-Prot	High
`Q851X7`	Oryza sativa subsp. japonica	sp\|Q851X7\|DERL2_ORYSJ Derlin-2	85.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card