TkA07G029680 | RubberDandelionOmics

Gene overview

TkA07G029680

Reference: TK1151 Chr: Chr07 Coordinates: 7939236-7941814 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1843 bp · TkA07G029680|TK1151|cDNA

CGCCCCTCACCTTTGATAACCCGTTTTCTTCTCTTGTTGATATATAAATTTCCCCCTCTTCTGCTCTTCACCATATACATCATAAAATTCACAGATTTCAATCGGTTATACAAGCTTCATACTTCACAAATGGCGTTAGCTGCTGCTTCTTCTTCTACTTCAATCGTTTTTTCATCTTCTAATCGTAAAGAGCAAGGCGTTCTGTTCAATTCAAACAATTATCAACCATCCGATCGGTCTCATCGATCACCAGCCGCTTT...

CDS

Download CDS FASTA

888 bp · TkA07G029680|TK1151|CDS

CGCCCCTCACCTTTGATAACCCGTTTTCTTCTCTTGTTGATATATAAATTTCCCCCTCTTCTGCTCTTCACCATATACATCATAAAATTCACAGATTTCAATCGGTTATACAAGCTTCATACTTCACAAATGGCGTTAGCTGCTGCTTCTTCTTCTACTTCAATCGTTTTTTCATCTTCTAATCGTAAAGAGCAAGGCGTTCTGTTCAATTCAAACAATTATCAACCATCCGATCGGTCTCATCGATCACCAGCCGCTTT...

Protein

Download Protein FASTA

295 aa · TkA07G029680|TK1151|PROTEIN

RPSPLITRFLLLLIYKFPPLLLFTIYIIKFTDFNRLYKLHTSQMALAAASSSTSIVFSSSNRKEQGVLFNSNNYQPSDRSHRSPAAFNLSQKRSTAVQALNAEPKRNDSIVPSAATVFAPDVAEKAVEVLDIEKLSKELENSSPLAIMDKALEKYGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYKFFDSVEKHYNIRIEYMFPDAIEVQALVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G029680`
TK1151 ID	TkA07G029680
OH-1004 ID	LXL04_027069
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 91.864 / OH-1004 53.137 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G029680

Location Chr07:7939236-7941814 (-)

Description Similar to APR1: 5'-adenylylsulfate reductase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04610`	Reduces sulfate for Cys biosynthesis.	No verified direct reference in this release
`At4g21990`	Reduces sulfate for Cys biosynthesis.	No verified direct reference in this release
`At1g62180`	Reduces sulfate for Cys biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0509800`	Reduces sulfate for Cys biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027069 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000103 sulfate assimilation Biological Process

GO:0019344 L-cysteine biosynthetic process Biological Process

GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin) Biological Process

GO:0070814 hydrogen sulfide biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity Molecular Function

GO:0009973 adenylyl-sulfate reductase activity Molecular Function

GO:0033741 adenylyl-sulfate reductase (glutathione) activity Molecular Function

GO:0043866 adenylyl-sulfate reductase (thioredoxin) activity Molecular Function

KEGG gene cross-reference

ath:AT1G62180

ath:AT4G04610

ath:AT4G21990

dosa:Os07g0509800

pae:PA1756

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkA07G029680 · TK1151

Mitochondrion0.031

Rank 2 · TkA07G029680 · TK1151

Cytoplasm0.019

Rank 3 · TkA07G029680 · TK1151

Nucleus0.016

Rank 4 · TkA07G029680 · TK1151

Peroxisome0.010

Rank 5 · TkA07G029680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01507PAPS_reduct159-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G029680	`PF01507`	PAPS_reduct	159	271	9.9e-27	94.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92979`	Arabidopsis thaliana	sp\|P92979\|APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic	79.100%	Swiss-Prot	Medium
`P92980`	Arabidopsis thaliana	sp\|P92980\|APR3_ARATH 5'-adenylylsulfate reductase 3, chloroplastic	67.800%	Swiss-Prot	High
`P92981`	Arabidopsis thaliana	sp\|P92981\|APR2_ARATH 5'-adenylylsulfate reductase 2, chloroplastic	67.200%	Swiss-Prot	High
`Q6Z4A7`	Oryza sativa subsp. japonica	sp\|Q6Z4A7\|APR1_ORYSJ Probable 5'-adenylylsulfate reductase 1, chloroplastic	83.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card