TkA07G022300 | RubberDandelionOmics

Gene overview

TkA07G022300

Reference: TK1151 Chr: Chr07 Coordinates: 6080496-6081782 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1056 bp · TkA07G022300|TK1151|cDNA

CAAAATATTTCCAACTTAATTTGAATATTTGATCAAATTTCTTGTAAATATTTTATCACGCCTGTTGTGCCAAGCCCTCTGTCTCTGTATTCCAAATATTTCCATCCCATTCCAAACGGCGACGGCGCCATATTTCAAAACAAATCTTCGCCTGGAGGGTGATCGAGTTTCACGTTTGTGATGAAGCAGCTTAATTTAGTACCAAAATCCAGCTTCCCGGACTCCCCAATCCCAAATCCCAACCCTAGAGACGGCGTCAA...

CDS

Download CDS FASTA

741 bp · TkA07G022300|TK1151|CDS

ATGAAGCAGCTTAATTTAGTACCAAAATCCAGCTTCCCGGACTCCCCAATCCCAAATCCCAACCCTAGAGACGGCGTCAATGGCGGAAATGTGACTGATTTAGGAAATGGGAGCGACGTCGTCTACATCCCCCGGTTTCTGACGCCGGAAAAATCATGGGAGTATTTCCATTACCTCAACAAACACATCCCATGGACCAGACCCACCATTCGCGTCTTCGGTAAACCTTGTCTCCAGCCAAGAGATGTATGCTATATCGC...

Protein

Download Protein FASTA

246 aa · TkA07G022300|TK1151|PROTEIN

MKQLNLVPKSSFPDSPIPNPNPRDGVNGGNVTDLGNGSDVVYIPRFLTPEKSWEYFHYLNKHIPWTRPTIRVFGKPCLQPRDVCYIASEGLKELSYSGYKPNAYSWDDFPPLKEILDEVHKAFPGSQFNSLLLNRYNNGNDYVGWHSDDEKLYGNTPEIASISFGCERDFLLKKRSYKKSKGEVEGEGPPRKRLKKNNDVEPYSFNLKHGSLLVMRGNTQRDWIHSVPKRVKAGSTRVNLTFRRVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G022300`
TK1151 ID	TkA07G022300
OH-1004 ID	LXL04_026977
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G022300

Location Chr07:6080496-6081782 (-)

Description Similar to ALKBH2: DNA oxidative demethylase ALKBH2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22260`	Dioxygenase that repairs alkylated DNA containing 1-methyladenine and 1-ethenoadenine by oxidative demethylation.	The DNA dioxygenase ALKBH2 protects Arabidopsis thaliana against methylation damage.2012 · DOI: 10.1093/nar/gks327

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026977 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006307 DNA alkylation repair Biological Process

GO:0008283 cell population proliferation Biological Process

GO:2000766 negative regulation of cytoplasmic translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000182 rDNA binding Molecular Function

GO:0008198 ferrous iron binding Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0035514 DNA demethylase activity Molecular Function

KEGG gene cross-reference

ath:AT2G22260

bta:511380

bta:514579

hsa:121642

hsa:221120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.831

Rank 1 · TkA07G022300 · TK1151

Cytoplasm0.226

Rank 2 · TkA07G022300 · TK1151

Mitochondrion0.049

Rank 3 · TkA07G022300 · TK1151

Cell membrane0.026

Rank 4 · TkA07G022300 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA07G022300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF135322OG-FeII_Oxy_240-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G022300	`PF13532`	2OG-FeII_Oxy_2	40	243	3.1e-34	119.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIE0`	Arabidopsis thaliana	sp\|Q9SIE0\|ALKB2_ARATH DNA oxidative demethylase ALKBH2	67.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card