TkA07G022220 | RubberDandelionOmics

Gene overview

TkA07G022220

Reference: TK1151 Chr: Chr07 Coordinates: 6040900-6042205 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

876 bp · TkA07G022220|TK1151|cDNA

AAAGAGATCATCATTAATCATTTAATCTTCATGCAATTGGGAAGACAATATATCAACTCAAGGCCAAGGAAAGTTACATAGTTAATTAAACATGATACCCTGGAGAAATGGGCCCAATCTGAAGCCCCTAAAAGATGCATCCACAGTAGATAGAATCAGCCCAAAAAGAGGTCGATTACTCGCGGCAATAGATTACGCTGCAGATGCAGACTGGCGGGAAAATCGCCCATTATTTTTCTTAAGGAGAAGTGCTGCATCTA...

CDS

Download CDS FASTA

681 bp · TkA07G022220|TK1151|CDS

ATGATACCCTGGAGAAATGGGCCCAATCTGAAGCCCCTAAAAGATGCATCCACAGTAGATAGAATCAGCCCAAAAAGAGGTCGATTACTCGCGGCAATAGATTACGCTGCAGATGCAGACTGGCGGGAAAATCGCCCATTATTTTTCTTAAGGAGAAGTGCTGCATCTAAGTTAATTAGATTCATGAAGGAATCCACACCAAAGCACGAAGATGGAGTTGATATGATCAGCAACTTGCCAAACGATGTTCTTCAGAAGAT...

Protein

Download Protein FASTA

226 aa · TkA07G022220|TK1151|PROTEIN

MIPWRNGPNLKPLKDASTVDRISPKRGRLLAAIDYAADADWRENRPLFFLRRSAASKLIRFMKESTPKHEDGVDMISNLPNDVLQKILSGIPSTEEVIQTSILSTRWRYLWTSVPFIDIDYTRGLNPLTQFDSNGFREFVYWVLLNKPLNLDSFRLWCADYYNMVTLRQWIHAAVMRKVKLLDLTFCPKEESEDVQIPHSLVTCDSLEVFDGISFMFAKNHRVLGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G022220`
TK1151 ID	TkA07G022220
OH-1004 ID	LXL04_026956
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.900
Protein coverage (%)	TK1151 64.159 / OH-1004 30.398 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G022220

Location Chr07:6040900-6042205 (+)

Description Similar to At1g78760: Putative F-box/FBD/LRR-repeat protein At1g78760

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At3g52680`	F-box/FBD/LRR-repeat protein At3g52680.	No verified direct reference in this release
`At4g10400`	FBD-associated F-box protein At4g10400.	No verified direct reference in this release
`At1g51370`	F-box/FBD/LRR-repeat protein At1g51370.	No verified direct reference in this release
`At4g09920`	F-box protein At4g09920.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026956 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G66290

ath:AT1G66310

ath:AT1G69630

ath:AT1G78750

ath:AT1G78760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.649

Rank 1 · TkA07G022220 · TK1151

Cytoplasm0.308

Rank 2 · TkA07G022220 · TK1151

Cell membrane0.061

Rank 3 · TkA07G022220 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA07G022220 · TK1151

Mitochondrion0.037

Rank 5 · TkA07G022220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box76-116 aa

PF12937F-box-like76-110 aa

PF23622LRR_At1g61320_AtMIF190-110 aa

PF23622LRR_At1g61320_AtMIF1147-203 aa

PF24758LRR_At5g56370167-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G022220	`PF00646`	F-box	76	116	3.3e-07	30.7
TkA07G022220	`PF12937`	F-box-like	76	110	0.0027	18.2
TkA07G022220	`PF23622`	LRR_At1g61320_AtMIF1	90	110	0.019	15.1
TkA07G022220	`PF23622`	LRR_At1g61320_AtMIF1	147	203	0.019	15.1
TkA07G022220	`PF24758`	LRR_At5g56370	167	216	0.11	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	34.100%	Swiss-Prot	Medium
`Q9LXJ6`	Arabidopsis thaliana	sp\|Q9LXJ6\|FDL21_ARATH F-box/FBD/LRR-repeat protein At3g52680	37.900%	Swiss-Prot	Medium
`Q9SV82`	Arabidopsis thaliana	sp\|Q9SV82\|FBD40_ARATH FBD-associated F-box protein At4g10400	32.400%	Swiss-Prot	Medium
`Q6DBN6`	Arabidopsis thaliana	sp\|Q6DBN6\|FDL6_ARATH F-box/FBD/LRR-repeat protein At1g51370	34.300%	Swiss-Prot	Medium
`Q9T0F1`	Arabidopsis thaliana	sp\|Q9T0F1\|FB226_ARATH F-box protein At4g09920	31.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card