TkA07G021230 | RubberDandelionOmics

Gene overview

TkA07G021230

Reference: TK1151 Chr: Chr07 Coordinates: 5775509-5777265 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

894 bp · TkA07G021230|TK1151|cDNA

ATGTCACTGGAAGACATTGTAAAAAGTATTGCAACATCTTCACAATCTTTCCAACAAGAAACTAAAGCAAGCATCAAAAATTTGGAACAACAGCTCTCCCAACTCGCCACTTCAGTGAGCAAAATTAATTCTCAAGGGAAATTGCCTGCACAAACTGAATCCAATCCAGGACACAAAGCCTGTGCGATTACCTTGAAGAGCGGTAAAAGCTACGAAGGTCCAAAAACTCCAGTAGACGAAGAAGAAGTTGATGAAGAAAT...

CDS

Download CDS FASTA

894 bp · TkA07G021230|TK1151|CDS

ATGTCACTGGAAGACATTGTAAAAAGTATTGCAACATCTTCACAATCTTTCCAACAAGAAACTAAAGCAAGCATCAAAAATTTGGAACAACAGCTCTCCCAACTCGCCACTTCAGTGAGCAAAATTAATTCTCAAGGGAAATTGCCTGCACAAACTGAATCCAATCCAGGACACAAAGCCTGTGCGATTACCTTGAAGAGCGGTAAAAGCTACGAAGGTCCAAAAACTCCAGTAGACGAAGAAGAAGTTGATGAAGAAAT...

Protein

Download Protein FASTA

297 aa · TkA07G021230|TK1151|PROTEIN

MSLEDIVKSIATSSQSFQQETKASIKNLEQQLSQLATSVSKINSQGKLPAQTESNPGHKACAITLKSGKSYEGPKTPVDEEEVDEEIVVEEPEAAKQNVQKQSEPNPIKVVERLELETSLLTTLCYGMQSPIELQLNCLGNNLPCRVVSGGMAMGWGVSGCRPYDAGGFRVVTKKVHFFCYDPETTGIVRGGLEFEPLNNLPCRVVSGGMAIGWGVSGCRPYDAGGFRVVTKKCTFLLRPGNHRHRKVCSPIHPNPSPSH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G021230`
TK1151 ID	TkA07G021230
OH-1004 ID	LXL04_003776
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.500
Protein coverage (%)	TK1151 18.182 / OH-1004 8.879 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G021230`
Location	Chr07:5775509-5777265 (-)
Description	Similar to At1g65750: Putative ribonuclease H protein At1g65750
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003776` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0009877 nodulation Biological Process GO:0016567 protein ubiquitination Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference	mtr:11418360 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.658

Rank 1 · TkA07G021230 · TK1151

Nucleus0.392

Rank 2 · TkA07G021230 · TK1151

Cell membrane0.068

Rank 3 · TkA07G021230 · TK1151

Mitochondrion0.065

Rank 4 · TkA07G021230 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA07G021230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04513Baculo_PEP_C3-44 aa

PF14282FlxA8-49 aa

PF14282FlxA96-102 aa

PF15055DMAC1_Dmo2143-151 aa

PF08894DUF1838154-189 aa

PF15055DMAC1_Dmo2201-209 aa

PF08894DUF1838212-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G021230	`PF04513`	Baculo_PEP_C	3	44	0.23	12.2
TkA07G021230	`PF14282`	FlxA	8	49	2.2	9.3
TkA07G021230	`PF14282`	FlxA	96	102	2.2	9.3
TkA07G021230	`PF15055`	DMAC1_Dmo2	143	151	1.8	9.5
TkA07G021230	`PF08894`	DUF1838	154	189	0.19	12.2
TkA07G021230	`PF15055`	DMAC1_Dmo2	201	209	1.8	9.5
TkA07G021230	`PF08894`	DUF1838	212	243	0.19	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card