TkA07G020870 | RubberDandelionOmics

Gene overview

TkA07G020870

Reference: TK1151 Chr: Chr07 Coordinates: 5654096-5663321 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2936 bp · TkA07G020870|TK1151|cDNA

TTGAAACCCAAAGTCGGATCTAGAGGTAAAAACGTATAAGTGCAGCGACTCAAAAGAAAGAGACAGGGTTGATCTCTCTCTCACACTGATCTCGATCATCAGGCAAGGTCTGCTGCTAGAAGAGGGAGAGAGGGAGAAAGGGTATACGAGCTATTGAATTTTCACAGAAGTCTTGCCTTAATGCCATAACCCCAGCAAAAGAAGGCCTTGAATAAGTGCATGAAGAAAATCCATTGAAGAAAGGTTCTTGACATTTTGAC...

CDS

Download CDS FASTA

2403 bp · TkA07G020870|TK1151|CDS

ATGGATGATGCCATGGAAACTGGTAATTTGGCTCCTTACCAAGACAGACCTAGAACCTTCCCAAACATGCGCAGTAAACCTACCACACCACTGATATTTCGAGTTCTTATGAGAATGAATGTCCGGTTACTTTCTGTGCTTTTGTTCTTGGGATTTGGAGCTATTTTCTACGTTGGAGCTAGTACATCACCAATCATTGTGTTTGTGTTCTCAGTATGCATAGTTAGTTTCATTATATCAATATATCTCACTAAATGGGT...

Protein

Download Protein FASTA

800 aa · TkA07G020870|TK1151|PROTEIN

MDDAMETGNLAPYQDRPRTFPNMRSKPTTPLIFRVLMRMNVRLLSVLLFLGFGAIFYVGASTSPIIVFVFSVCIVSFIISIYLTKWVLAKDEGPPEMGQISDAIRDGAEGFFRTQYGSISKMALFLAVVIFGIYMFRSLTPQQEASGIGRLTSASITVFSFLLGAVCSGMAGYVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSALVVVGMAVIGVAILYATFYVYLGVDTPGSMKVTELPLLLVGYGFGASFVAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G020870`
TK1151 ID	TkA07G020870
OH-1004 ID	LXL04_026961
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G020870

Location Chr07:5654096-5663321 (-)

Description Similar to AVPL2: Pyrophosphate-energized membrane proton pump 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78920`	May catalyze inorganic pyrophosphate hydrolysis and mediate H⁺ transport.	AVP2, a sequence-divergent, K(+)-insensitive H(+)-translocating inorganic pyrophosphatase from Arabidopsis.2000 · DOI: 10.1104/pp.123.1.353
`At1g16780`	Pyrophosphate-energized membrane proton pump 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026961 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004427 inorganic diphosphate phosphatase activity Molecular Function

GO:0009678 diphosphate hydrolysis-driven proton transmembrane transporter activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G16780

ath:AT1G78920

mta:Moth_0418

rru:Rru_A1818

tte:TTE0284

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.351

Rank 1 · TkA07G020870 · TK1151

Lysosome / Vacuole0.184

Rank 2 · TkA07G020870 · TK1151

Cell membrane0.177

Rank 3 · TkA07G020870 · TK1151

Cytoplasm0.127

Rank 4 · TkA07G020870 · TK1151

Golgi apparatus0.127

Rank 5 · TkA07G020870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24456RHD_RETREG1-343-89 aa

PF10857DUF270166-91 aa

PF03030H_PPase74-795 aa

PF24456RHD_RETREG1-3176-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G020870	`PF24456`	RHD_RETREG1-3	43	89	0.88	9.8
TkA07G020870	`PF10857`	DUF2701	66	91	1.1	10.0
TkA07G020870	`PF03030`	H_PPase	74	795	3.2e-254	846.2
TkA07G020870	`PF24456`	RHD_RETREG1-3	176	230	0.88	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56ZN6`	Arabidopsis thaliana	sp\|Q56ZN6\|AVP2_ARATH Pyrophosphate-energized membrane proton pump 2	85.400%	Swiss-Prot	High
`Q9FWR2`	Arabidopsis thaliana	sp\|Q9FWR2\|AVPX_ARATH Pyrophosphate-energized membrane proton pump 3	84.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card