TkA07G020720 | RubberDandelionOmics

Gene overview

TkA07G020720

Reference: TK1151 Chr: Chr07 Coordinates: 5598000-5604519 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

652 bp · TkA07G020720|TK1151|cDNA

ATTACTAATAGCAGTGAGCAATGGCTGATATCGCAGCAGATTGGGCGGGAAACAGACGAAATCGTTCGCAATCGACCATTGAGTTTTAAACTTGAAGGTGCGGCCGTGCTGCTGCTACTGTATATTATTAATCAGGTAACTCAGTTGGAAGAGTGGAAACTCGATGATGTGGCAGAAATGAAAGTTTTGACTCGTTGTCTGAAATTGGTCAAGTTTGTTGGTTTTGATGGGGATGAGCAGAAAGTGGTTGTAGCTCGTTC...

CDS

Download CDS FASTA

1383 bp · TkA07G020720|TK1151|CDS

ATGAAGAAATCCAAACAAGTAAAGACACCAGAACTCGAAGATGAGGTTGATAAGATCAGTAACATGCCAGATCTTGTTCTTCAACTGATTCTTTCAAATATTCCAAGTACCGAAGAAGTAATCCGAACCAGCATTTTATCAACAAGATGGAGATATTTATGGACTTCAGTTCCATTTATAGACATAGACCAAACCCGAGGACTAAACCCCGTTAAACATTTCGATAGTAACGGATTCAGAGAGTTTGTGTATTGGGTTTT...

Protein

Download Protein FASTA

460 aa · TkA07G020720|TK1151|PROTEIN

MKKSKQVKTPELEDEVDKISNMPDLVLQLILSNIPSTEEVIRTSILSTRWRYLWTSVPFIDIDQTRGLNPVKHFDSNGFREFVYWVLLNKPLDLDCFRLRCFNYYSMSTLSRWIHAAVMRKVKLLDLMLCPKEESDDIQIPHSLVTCDSLEVLKLCLLGSPLCVPNITGFQALRVLVLNDVEFVNDHSVKCFFKNCPLLEDLSLFDCCTHNLYALEISCPNLKRLTIIYRDGVSYEEFCNDKGMCNDLEISCPKLVFLML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G020720`
TK1151 ID	TkA07G020720
OH-1004 ID	LXL04_026956
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.400
Protein coverage (%)	TK1151 99.565 / OH-1004 96.017 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G020720

Location Chr07:5598000-5604519 (-)

Description Similar to At1g78760: Putative F-box/FBD/LRR-repeat protein At1g78760

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At1g66310`	FBD-associated F-box protein At1g66310.	No verified direct reference in this release
`At1g66290`	Putative F-box/FBD/LRR-repeat protein At1g66290.	No verified direct reference in this release
`At1g78760`	Putative F-box/FBD/LRR-repeat protein At1g78760.	No verified direct reference in this release
`At1g78750`	F-box/FBD/LRR-repeat protein At1g78750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026956 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G66290

ath:AT1G66310

ath:AT1G69630

ath:AT1G78750

ath:AT1G78760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.844

Rank 1 · TkA07G020720 · TK1151

Cytoplasm0.237

Rank 2 · TkA07G020720 · TK1151

Endoplasmic reticulum0.034

Rank 3 · TkA07G020720 · TK1151

Cell membrane0.033

Rank 4 · TkA07G020720 · TK1151

Plastid0.018

Rank 5 · TkA07G020720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF119-53 aa

PF00646F-box19-59 aa

PF23622LRR_At1g61320_AtMIF191-420 aa

PF23598LRR_1493-153 aa

PF24758LRR_At5g56370110-228 aa

PF23286LRR_13133-186 aa

PF12799LRR_4144-155 aa

PF23598LRR_14164-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G020720	`PF23622`	LRR_At1g61320_AtMIF1	19	53	8.6e-12	45.8
TkA07G020720	`PF00646`	F-box	19	59	7.8e-07	29.5
TkA07G020720	`PF23622`	LRR_At1g61320_AtMIF1	91	420	8.6e-12	45.8
TkA07G020720	`PF23598`	LRR_14	93	153	2e-05	24.3
TkA07G020720	`PF24758`	LRR_At5g56370	110	228	8.5e-14	52.5
TkA07G020720	`PF23286`	LRR_13	133	186	0.0016	18.9
TkA07G020720	`PF12799`	LRR_4	144	155	0.0081	17.1
TkA07G020720	`PF23598`	LRR_14	164	193	2e-05	24.3
TkA07G020720	`PF12799`	LRR_4	166	180	0.0081	17.1
TkA07G020720	`PF08387`	FBD	189	203	0.00013	22.5
TkA07G020720	`PF12799`	LRR_4	199	227	0.0081	17.1
TkA07G020720	`PF12799`	LRR_4	251	262	0.0081	17.1
TkA07G020720	`PF23598`	LRR_14	272	369	2e-05	24.3
TkA07G020720	`PF08387`	FBD	276	281	0.00013	22.5
TkA07G020720	`PF24758`	LRR_At5g56370	326	361	8.5e-14	52.5
TkA07G020720	`PF12799`	LRR_4	326	337	0.0081	17.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWZ1`	Arabidopsis thaliana	sp\|Q9FWZ1\|FBL13_ARATH F-box/LRR-repeat protein 13	29.800%	Swiss-Prot	Low
`Q9C8Y6`	Arabidopsis thaliana	sp\|Q9C8Y6\|FBD5_ARATH FBD-associated F-box protein At1g66310	30.000%	Swiss-Prot	Medium
`Q9C8Y8`	Arabidopsis thaliana	sp\|Q9C8Y8\|FDL7_ARATH Putative F-box/FBD/LRR-repeat protein At1g66290	28.000%	Swiss-Prot	Low
`Q9ZV94`	Arabidopsis thaliana	sp\|Q9ZV94\|FDL11_ARATH Putative F-box/FBD/LRR-repeat protein At1g78760	26.800%	Swiss-Prot	Low
`Q9ZV93`	Arabidopsis thaliana	sp\|Q9ZV93\|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750	25.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card