TkA07G020480 | RubberDandelionOmics

Gene overview

TkA07G020480

Reference: TK1151 Chr: Chr07 Coordinates: 5532922-5535357 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1801 bp · TkA07G020480|TK1151|cDNA

AAAAGTATGGATCACATGCGACAAAGTTGATATTTCAAGTTGAAATGAAAAATATGAATGTAAAACTGATAAAGGCGGGAAAGAAAAAGCAATGCCAGTAATATCGAGAAGCAAGGCGGGAACAAAAGGCGGGAAAAGAAAAAAAAATGGAAAACAGTACTCTTTCATCCTAAATCAATGAAAATTTCTCTTGGAATCGAACTACACTCAAAACAATCATATCCGAGCTTCAATCAGTAAACGAGACATGAAGAAGTCCA...

CDS

Download CDS FASTA

1398 bp · TkA07G020480|TK1151|CDS

ATGAAGAAGTCCAAGCACGAAAACTCATCCGAGCTTGAAGATGGTGCTGATAGGATCAGTAGCTTACCTGATCCGATTCTTCAATTGATACTTTCACGTATTCCAACTACCGAAGAAATAATGCGAACCAGCATTTTGTCAACACGATGGAGGTATTTATGGAAATCACTTCCCTCTATTGACATAGATTGTTCCCGAGGATCGGAATTCGACAGGAACAAATTCAAAAAGTTCGTCGATCATGTTCTATCAAACAACTC...

Protein

Download Protein FASTA

465 aa · TkA07G020480|TK1151|PROTEIN

MKKSKHENSSELEDGADRISSLPDPILQLILSRIPTTEEIMRTSILSTRWRYLWKSLPSIDIDCSRGSEFDRNKFKKFVDHVLSNNSLDLDNLRLSCSHHYNQSTIWRWVQAAVHRNIKQLHLLFCCGNSCDNIELPSSLMNCNSLQVLRLSLSEERRISLPNVTGFHALRVLELNKLELSRKQSLLKKFLESIPLLEDLSLIDCEIKQLKLVTISCRNLKSLRIDNRNIFDPDDLFDLDSLCGGVKIDCPKLVFFEFGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G020480`
TK1151 ID	TkA07G020480
OH-1004 ID	LXL04_026956
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.600
Protein coverage (%)	TK1151 97.634 / OH-1004 94.549 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G020480

Location Chr07:5532922-5535357 (+)

Description Similar to At1g78760: Putative F-box/FBD/LRR-repeat protein At1g78760

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78760`	Putative F-box/FBD/LRR-repeat protein At1g78760.	No verified direct reference in this release
`At5g25850`	Putative F-box/FBD/LRR-repeat protein At5g25850.	No verified direct reference in this release
`At1g66290`	Putative F-box/FBD/LRR-repeat protein At1g66290.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026956 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G66290

ath:AT1G66310

ath:AT1G69630

ath:AT1G78750

ath:AT1G78760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.843

Rank 1 · TkA07G020480 · TK1151

Cytoplasm0.246

Rank 2 · TkA07G020480 · TK1151

Cell membrane0.036

Rank 3 · TkA07G020480 · TK1151

Endoplasmic reticulum0.034

Rank 4 · TkA07G020480 · TK1151

Plastid0.014

Rank 5 · TkA07G020480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box19-58 aa

PF12937F-box-like19-53 aa

PF23622LRR_At1g61320_AtMIF127-80 aa

PF12799LRR_483-93 aa

PF12937F-box-like89-102 aa

PF23622LRR_At1g61320_AtMIF190-430 aa

PF24758LRR_At5g56370108-226 aa

PF12799LRR_4120-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G020480	`PF00646`	F-box	19	58	9.4e-08	32.4
TkA07G020480	`PF12937`	F-box-like	19	53	0.0043	17.5
TkA07G020480	`PF23622`	LRR_At1g61320_AtMIF1	27	80	3.7e-11	43.8
TkA07G020480	`PF12799`	LRR_4	83	93	3.8	8.6
TkA07G020480	`PF12937`	F-box-like	89	102	0.0043	17.5
TkA07G020480	`PF23622`	LRR_At1g61320_AtMIF1	90	430	3.7e-11	43.8
TkA07G020480	`PF24758`	LRR_At5g56370	108	226	5.7e-12	46.5
TkA07G020480	`PF12799`	LRR_4	120	152	3.8	8.6
TkA07G020480	`PF23598`	LRR_14	134	242	0.091	12.2
TkA07G020480	`PF12799`	LRR_4	151	176	3.8	8.6
TkA07G020480	`PF12799`	LRR_4	197	230	3.8	8.6
TkA07G020480	`PF08387`	FBD	202	216	0.0045	17.6
TkA07G020480	`PF08387`	FBD	300	310	0.0045	17.6
TkA07G020480	`PF12799`	LRR_4	316	334	3.8	8.6
TkA07G020480	`PF24758`	LRR_At5g56370	325	361	5.7e-12	46.5
TkA07G020480	`PF23598`	LRR_14	325	374	0.091	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV94`	Arabidopsis thaliana	sp\|Q9ZV94\|FDL11_ARATH Putative F-box/FBD/LRR-repeat protein At1g78760	27.500%	Swiss-Prot	Low
`Q3E944`	Arabidopsis thaliana	sp\|Q3E944\|FDL33_ARATH Putative F-box/FBD/LRR-repeat protein At5g25850	27.600%	Swiss-Prot	Low
`Q9C8Y8`	Arabidopsis thaliana	sp\|Q9C8Y8\|FDL7_ARATH Putative F-box/FBD/LRR-repeat protein At1g66290	21.900%	Swiss-Prot	Low
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	31.600%	Swiss-Prot	Medium
`Q9FWZ1`	Arabidopsis thaliana	sp\|Q9FWZ1\|FBL13_ARATH F-box/LRR-repeat protein 13	29.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card