TkA07G016630 | RubberDandelionOmics

Gene overview

TkA07G016630

Reference: TK1151 Chr: Chr07 Coordinates: 4507844-4510227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1037 bp · TkA07G016630|TK1151|cDNA

TCCCTTTTCAAAAGTTTGATTTCTTTGCTATGTTAGTCGGTAACGATCTTCGTATAAAAATGAGCTGTTTGATTCATCGACGAACTGGTTAACGGCTTCCGATTAGGATGGAAAACACAGAAGCAACTTTCTCTACATTTGGTATTTCAGAAGAGGAAGGCGACAAGCTTGTAGCAGAAGTAATCCGCTATATCCTTTTCAAATCACATCATAATTCTGGATGTCCAATCAAAAGAGATGAACTCACTCAACTAATCACA...

CDS

Download CDS FASTA

708 bp · TkA07G016630|TK1151|CDS

ATGATGGAAAACACAGAAGCAACTTTCTCTACATTTGGTATTTCAGAAGAGGAAGGCGACAAGCTTGTAGCAGAAGTAATCCGCTATATCCTTTTCAAATCACATCATAATTCTGGATGTCCAATCAAAAGAGATGAACTCACTCAACTAATCACAAAAAACTATCCACAAAGATCACTTCCAAGTCTTGTTCTCAATAAGGCCACCACAAAACTTTCCACCATTTTTGGGTACAATTTGAAGGAACTTCAGCGGGCCCG...

Protein

Download Protein FASTA

235 aa · TkA07G016630|TK1151|PROTEIN

MMENTEATFSTFGISEEEGDKLVAEVIRYILFKSHHNSGCPIKRDELTQLITKNYPQRSLPSLVLNKATTKLSTIFGYNLKELQRARPSSNNQTRNSQSSADTKSYIVTSQLDPGVYRKLVEDTKNSHLTGFAFVVIGIVHLAGGKITEESLWHHLGRLGMTQSDERHTDFGSTKQTIETLVQQRYLQKDKTNGPEGLTLIYELAERGLDAALSSTFKDCLSQIVTSEATAIGLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G016630`
TK1151 ID	TkA07G016630
OH-1004 ID	LXL04_026900
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 99.574 / OH-1004 92.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G016630`
Location	Chr07:4507844-4510227 (-)
Description	Similar to Nsmce3: Non-structural maintenance of chromosomes element 3 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026900` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0016925 protein sumoylation Biological Process GO:0031398 positive regulation of protein ubiquitination Biological Process GO:0032204 regulation of telomere maintenance Biological Process GO:0034644 cellular response to UV Biological Process GO:0045746 negative regulation of Notch signaling pathway Biological Process GO:0045787 positive regulation of cell cycle Biological Process
KEGG gene cross-reference	hsa:4100 hsa:4103 hsa:4107 hsa:56160 mmu:66647 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.863

Rank 1 · TkA07G016630 · TK1151

Cytoplasm0.293

Rank 2 · TkA07G016630 · TK1151

Mitochondrion0.022

Rank 3 · TkA07G016630 · TK1151

Cell membrane0.022

Rank 4 · TkA07G016630 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA07G016630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01454MAGE26-209 aa

PF10557Cullin_Nedd844-58 aa

PF20268SBDS_C96-126 aa

PF10557Cullin_Nedd8174-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G016630	`PF01454`	MAGE	26	209	1.9e-40	139.6
TkA07G016630	`PF10557`	Cullin_Nedd8	44	58	0.059	14.2
TkA07G016630	`PF20268`	SBDS_C	96	126	0.13	13.0
TkA07G016630	`PF10557`	Cullin_Nedd8	174	193	0.059	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card