Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1864 bp · TkA07G009820|TK1151|cDNA
TTTACCCATTCTTCCTTCCGGAATCCGGAGTTTACACGACGTCGGGTCTTGTGGTGAATGGACCCTGAAACTTGTACTAGTAAAAAAAAACCTCGATCGCGGACTCTTCTTCCGAATCGAATTGGAATTCACAACCTTCTTATCTGTTGATCCTTATCGCAAATTAACTCAACATGGAACCGATCGTACCAATCGCAGTAGTTACCTCTCTGATTCTCGGAGCTCTGATCGCTTTTGTAGCCTTAGGTAGCTACTTTCGC...
1296 bp · TkA07G009820|TK1151|CDS
ATGGAACCGATCGTACCAATCGCAGTAGTTACCTCTCTGATTCTCGGAGCTCTGATCGCTTTTGTAGCCTTAGGTAGCTACTTTCGCAAGAGGAAATCGGAGGTTGTGTCAATCGCAAAGCCCGCAGAAGCGGCGGTAGCGAATCTGAGGAATTCAAGGCCTCAGCAAACTAAGAAATCTCAGTCCAAGCCTCATCATTCACATGCTGATAAGGATTTAAACAAGCGCCATCACCCATTAGACTTAAATACTTTAAAAGG...
Protein
Download Protein FASTA431 aa · TkA07G009820|TK1151|PROTEIN
MEPIVPIAVVTSLILGALIAFVALGSYFRKRKSEVVSIAKPAEAAVANLRNSRPQQTKKSQSKPHHSHADKDLNKRHHPLDLNTLKGHGDSVNGLCFSSDGHSLATACDDGVVRVFKLDDASSKSFKFMRINLPAGGHPTAVAFVDDAYSVVVASQNLTGANLYMYGEDKPKSGDNIQQSKPEIKWEHHNVHDKKYIITLFGTKATHGAADGSTIIASSSEGTDIKLWHGKSGKMLGNVDTNQLKNNMATVSPDGRFIAA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G009820 |
|---|---|
| TK1151 ID | TkA07G009820 |
| OH-1004 ID | LXL04_026824 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G009820 |
|---|---|
| Location | Chr07:2680770-2685621 (-) |
| Description | Similar to TBL2: Transducin beta-like protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0030968 endoplasmic reticulum unfolded protein response Biological Process GO:0042149 cellular response to glucose starvation Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0003723 RNA binding Molecular Function GO:0004197 cysteine-type endopeptidase activity Molecular Function GO:0019901 protein kinase binding Molecular Function GO:0031369 translation initiation factor binding Molecular Function GO:0051219 phosphoprotein binding Molecular Function |
| KEGG gene cross-reference | ana:all2124 hsa:26608 mmu:27368 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24807WD40_CDC20-Fz71-128 aaPF23756Beta-prop_HPS573-126 aaPF23769Beta-prop_WDR75_2nd78-123 aaPF25178Beta-prop_WDR4180-118 aaPF25047Beta-prop_TEP1_2nd81-116 aaPF24796WDR5581-124 aaPF00400WD4082-116 aaPF23381Beta-prop_IFT122_1st82-119 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G009820 | PF24807 | WD40_CDC20-Fz | 71 | 128 | 1.3e-17 | 64.7 |
| TkA07G009820 | PF23756 | Beta-prop_HPS5 | 73 | 126 | 3e-06 | 27.4 |
| TkA07G009820 | PF23769 | Beta-prop_WDR75_2nd | 78 | 123 | 8.8e-08 | 32.0 |
| TkA07G009820 | PF25178 | Beta-prop_WDR41 | 80 | 118 | 1e-10 | 41.7 |
| TkA07G009820 | PF25047 | Beta-prop_TEP1_2nd | 81 | 116 | 3.3e-14 | 53.4 |
| TkA07G009820 | PF24796 | WDR55 | 81 | 124 | 8.5e-14 | 52.0 |
| TkA07G009820 | PF00400 | WD40 | 82 | 116 | 3.3e-28 | 97.6 |
| TkA07G009820 | PF23381 | Beta-prop_IFT122_1st | 82 | 119 | 5.4e-27 | 95.5 |
| TkA07G009820 | PF25174 | Beta-prop_THOC3 | 82 | 188 | 5.9e-26 | 91.8 |
| TkA07G009820 | PF24805 | EIF3I | 82 | 121 | 1.6e-14 | 54.5 |
| TkA07G009820 | PF23411 | Beta-prop_Vps41 | 82 | 130 | 2.3e-06 | 27.9 |
| TkA07G009820 | PF25175 | Beta-prop_WDR5 | 83 | 121 | 1.1e-27 | 97.8 |
| TkA07G009820 | PF24814 | WD40_Prp19 | 83 | 157 | 1.6e-24 | 87.2 |
| TkA07G009820 | PF25173 | Beta-prop_WDR3_1st | 83 | 120 | 7.4e-22 | 78.6 |
| TkA07G009820 | PF25172 | Beta-prop_WDR3_2nd | 83 | 117 | 5e-16 | 59.5 |
| TkA07G009820 | PF25391 | WD40_Gbeta | 83 | 119 | 2.1e-13 | 50.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.