TkA07G006000 | RubberDandelionOmics

Gene overview

TkA07G006000

Reference: TK1151 Chr: Chr07 Coordinates: 1678544-1683084 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2078 bp · TkA07G006000|TK1151|cDNA

CTCACCACACCAAACAACCATAGAAGCCATTACAACCATATATTATAAATTGTACATCATGCATTAAATATTGTACATTTGTCTGGATTTTGATTTTTACTTATATTTTCTCTGAACAGTTGTTTCATAAAGTGTGAATCTTGGAGCTTGCGTCTGCCATTACAGAGGAATTCGAAGCAGAAGAAGACGAAAGAAGCAATTTTTTTCGAATTTTGAATGCGATTGTTCATTCCGTGCTTGCTTCACTCACTTTTATCCAT...

CDS

Download CDS FASTA

1653 bp · TkA07G006000|TK1151|CDS

ATGGGTGACCTCCGATTAGCAGAAGAGTGGCTTTCACGTGCTAAAGATCTTGTTCCGGTGGCTTTACAAAAGGCGCGAGAAGTTAAAGAATTTCCAGGAAGATGGAAAATGATTATATCTCGATTAGAGCAAATCCCATCTCGTTTATCAGATTTATCAAGCCACCCCTGTTTCTCGAAGAACACGTTATGCAACGAGCAATTAGAATCAATTTCCAAGACTTTAAACGAATCAATCGAGTTAGCAGAAACATGTTCGAA...

Protein

Download Protein FASTA

550 aa · TkA07G006000|TK1151|PROTEIN

MGDLRLAEEWLSRAKDLVPVALQKAREVKEFPGRWKMIISRLEQIPSRLSDLSSHPCFSKNTLCNEQLESISKTLNESIELAETCSKGKFDGKLQMQSDLDSLSGKLDLNLRDCGLLIKTGVLGEVTMGSDLEGTSHRSTENNIRELLARLQIGHLEAKHKALDTLVDVMKEDEKTVLSFVGRTNIGALVQLLTATSPRIREKTVTLICSLAESGGCESWLVSEGVLPPLIRLLESGSSIGREKSVIALQRLSMSEETAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G006000`
TK1151 ID	TkA07G006000
OH-1004 ID	LXL04_026755
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G006000`
Location	Chr07:1678544-1683084 (-)
Description	Similar to PUB3: U-box domain-containing protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026755` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007166 cell surface receptor signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0034614 cellular response to reactive oxygen species Biological Process GO:0048364 root development Biological Process GO:0048658 anther wall tapetum development Biological Process GO:1904821 chloroplast disassembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference	ath:AT2G23140 ath:AT3G54790 ath:AT5G42340 ath:AT5G67340 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · TkA07G006000 · TK1151

Nucleus0.367

Rank 2 · TkA07G006000 · TK1151

Cell membrane0.218

Rank 3 · TkA07G006000 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA07G006000 · TK1151

Golgi apparatus0.041

Rank 5 · TkA07G006000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23005DUF703213-122 aa

PF28415SIL1_FES1_HPBP1_C70-104 aa

PF25598ARM_PUB130-268 aa

PF20168PDS5135-197 aa

PF24436INTS7_N138-212 aa

PF23628ARM_LIN_C140-211 aa

PF14664RICTOR_N141-171 aa

PF24768ARM_ARMC5144-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G006000	`PF23005`	DUF7032	13	122	1.8e-38	131.6
TkA07G006000	`PF28415`	SIL1_FES1_HPBP1_C	70	104	0.013	15.7
TkA07G006000	`PF25598`	ARM_PUB	130	268	3e-13	50.6
TkA07G006000	`PF20168`	PDS5	135	197	0.12	10.9
TkA07G006000	`PF24436`	INTS7_N	138	212	0.095	12.5
TkA07G006000	`PF23628`	ARM_LIN_C	140	211	0.05	13.3
TkA07G006000	`PF14664`	RICTOR_N	141	171	0.08	12.6
TkA07G006000	`PF24768`	ARM_ARMC5	144	243	1.6e-22	81.0
TkA07G006000	`PF25151`	TPR_Trm732_C	144	166	0.062	13.9
TkA07G006000	`PF01365`	RYDR_ITPR	148	213	0.06	13.6
TkA07G006000	`PF21047`	HEAT_Maestro	151	214	0.017	15.7
TkA07G006000	`PF11698`	V-ATPase_H_C	157	200	0.09	13.6
TkA07G006000	`PF21050`	ARMC9_ARM	158	203	0.0048	17.6
TkA07G006000	`PF13646`	HEAT_2	159	176	9.8e-10	39.3
TkA07G006000	`PF00514`	Arm	160	176	3.6e-27	94.2
TkA07G006000	`PF11841`	ELMO_ARM	161	211	0.13	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card