TkA07G005580 | RubberDandelionOmics

Gene overview

TkA07G005580

Reference: TK1151 Chr: Chr07 Coordinates: 1550282-1556002 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2168 bp · TkA07G005580|TK1151|cDNA

TATCAGATGATCTTCAATATGCTTAAAAGACACTCATCCATGGTCGCTGGATCTTCTTCACTCAGCTTCAAGTTCCAACATCCATATCTAAATCCACCCAAAACCCTTGCACACATCAATTTCATACAAACAGATCTCAAATTGTAATATATTAAAAATCCGTATATCTGAATCCGTTCTGATAATGGCTAATCACGATCTCACCTCATCAAAGCACCAAGCTACCCAAGCCCGAAAATGGCGGTTCCTCGACTTCGTAT...

CDS

Download CDS FASTA

1803 bp · TkA07G005580|TK1151|CDS

ATGGCTAATCACGATCTCACCTCATCAAAGCACCAAGCTACCCAAGCCCGAAAATGGCGGTTCCTCGACTTCGTATCTCTCATCTTCTTCTTTGCAATATTCCTTTTCTTCGTTCTCGTCCTCACGCCGCTAGGAGATTCCATCGCCGCCACCGGCAGCCAAGCGCTCATCACCTCCACCACCGGCGCCAAGCGTCGACACCACCTCATTGCCCTAATTGAAACCGGAAGAAACCTAACGCTTCAATCATGTTCTGCTGA...

Protein

Download Protein FASTA

600 aa · TkA07G005580|TK1151|PROTEIN

MANHDLTSSKHQATQARKWRFLDFVSLIFFFAIFLFFVLVLTPLGDSIAATGSQALITSTTGAKRRHHLIALIETGRNLTLQSCSADTVDYMPCEDPNRNRLLSREMNSYRERHCPPPEERPLCLIPPPVGYNIPIQWPTSLYKIWHENMPYNKLADRKGHQGWMKKEGPHFIFPGGGTMFPDGAVKYIEQLEHYIPISGGTLRTVLDMGCGVASFGGFLLAEDLLTVSFAPRDSHKSQIQFALERGIPAFVLMLGTLRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G005580`
TK1151 ID	TkA07G005580
OH-1004 ID	LXL04_010683
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.000
Protein coverage (%)	TK1151 99.833 / OH-1004 99.683 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G005580

Location Chr07:1550282-1556002 (-)

Description Similar to At4g00740: Probable methyltransferase PMT13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00740`	S-adenosyl-L-methionine (SAM)-dependent methyltransferase (MTase) which mediates the methylesterification of the pectin homogalacturonan (HG) and thus regulates cell wall biosynthesis, at least in suspension-cultured cells.	QUASIMODO 3 (QUA3) is a putative homogalacturonan methyltransferase regulating cell wall biosynthesis in Arabidopsis suspension-cultured cells.2011 · DOI: 10.1093/jxb/err211
`At4g00750`	Probable methyltransferase PMT15.	No verified direct reference in this release
`At1g33170`	Probable methyltransferase PMT18.	No verified direct reference in this release
`At2g45750`	Probable methyltransferase PMT16.	No verified direct reference in this release
`At4g10440`	Probable methyltransferase PMT17.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010683 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0052546 cell wall pectin metabolic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G26850

ath:AT1G33170

ath:AT4G00740

ath:AT4G00750

ath:AT4G10440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.776

Rank 1 · TkA07G005580 · TK1151

Endoplasmic reticulum0.079

Rank 2 · TkA07G005580 · TK1151

Cell membrane0.065

Rank 3 · TkA07G005580 · TK1151

Extracellular0.060

Rank 4 · TkA07G005580 · TK1151

Cytoplasm0.041

Rank 5 · TkA07G005580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_2990-590 aa

PF13847Methyltransf_31205-321 aa

PF13649Methyltransf_25206-298 aa

PF08241Methyltransf_11207-302 aa

PF08242Methyltransf_12207-300 aa

PF20922Anamorsin_N262-306 aa

PF08242Methyltransf_12505-547 aa

PF13847Methyltransf_31525-553 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G005580	`PF03141`	Methyltransf_29	90	590	6.1e-201	669.1
TkA07G005580	`PF13847`	Methyltransf_31	205	321	1e-07	32.5
TkA07G005580	`PF13649`	Methyltransf_25	206	298	2.3e-05	25.7
TkA07G005580	`PF08241`	Methyltransf_11	207	302	1.5e-08	35.8
TkA07G005580	`PF08242`	Methyltransf_12	207	300	0.00072	21.0
TkA07G005580	`PF20922`	Anamorsin_N	262	306	0.23	11.9
TkA07G005580	`PF08242`	Methyltransf_12	505	547	0.00072	21.0
TkA07G005580	`PF13847`	Methyltransf_31	525	553	1e-07	32.5
TkA07G005580	`PF08241`	Methyltransf_11	532	548	1.5e-08	35.8
TkA07G005580	`PF13649`	Methyltransf_25	532	545	2.3e-05	25.7
TkA07G005580	`PF20922`	Anamorsin_N	532	552	0.23	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W95`	Arabidopsis thaliana	sp\|Q93W95\|PMTD_ARATH Probable pectin methyltransferase QUA3	66.100%	Swiss-Prot	High
`Q9ZPH9`	Arabidopsis thaliana	sp\|Q9ZPH9\|PMTF_ARATH Probable methyltransferase PMT15	44.700%	Swiss-Prot	Medium
`Q9C884`	Arabidopsis thaliana	sp\|Q9C884\|PMTI_ARATH Probable methyltransferase PMT18	44.500%	Swiss-Prot	Medium
`O80844`	Arabidopsis thaliana	sp\|O80844\|PMTG_ARATH Probable methyltransferase PMT16	45.600%	Swiss-Prot	Medium
`Q9SZX8`	Arabidopsis thaliana	sp\|Q9SZX8\|PMTH_ARATH Probable methyltransferase PMT17	43.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card