TkA07G003440 | RubberDandelionOmics

Gene overview

TkA07G003440

Reference: TK1151 Chr: Chr07 Coordinates: 924894-927509 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1395 bp · TkA07G003440|TK1151|cDNA

ATGGTTGCCGGACCACCATCTTCCTCCGCATCTCCGTCGTCATCTTCTTCGGCTGTTTCCACTCCTCAGTTGGGGTTTGATCCAATGCAGCAGCAGCAGCAACAGCAGAGACAGTCATTACAACAACAACTACTTCGAAACCCTGAAGGAAGAGAAGCAATGTTAGCCTATCAATCTGGAAACCTACAAGGAGTATTAGGAGGATCATCATCATCCAATTCCATTCAAATCCAACAGGGGCAAAATCGTAATAATCCAAA...

CDS

Download CDS FASTA

1395 bp · TkA07G003440|TK1151|CDS

ATGGTTGCCGGACCACCATCTTCCTCCGCATCTCCGTCGTCATCTTCTTCGGCTGTTTCCACTCCTCAGTTGGGGTTTGATCCAATGCAGCAGCAGCAGCAACAGCAGAGACAGTCATTACAACAACAACTACTTCGAAACCCTGAAGGAAGAGAAGCAATGTTAGCCTATCAATCTGGAAACCTACAAGGAGTATTAGGAGGATCATCATCATCCAATTCCATTCAAATCCAACAGGGGCAAAATCGTAATAATCCAAA...

Protein

Download Protein FASTA

464 aa · TkA07G003440|TK1151|PROTEIN

MVAGPPSSSASPSSSSSAVSTPQLGFDPMQQQQQQQRQSLQQQLLRNPEGREAMLAYQSGNLQGVLGGSSSSNSIQIQQGQNRNNPNFDQQQHMMNNPYAQYAFQNQQKTRMSPIGPSKDQSKNPLDEVHLAVSSIPDQSQGQSQNQKQFAVPTSGGSMRPIMGGPQGGSMAAQLQAMQAMALERNIDLSLPQNAHFMAQLIPLMQAKMQKANESNNMGPTMPRQQQSMPPGHPGQSQGQGQQVSLRQGSGSGSGVSSSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G003440`
TK1151 ID	TkA07G003440
OH-1004 ID	LXL04_026715
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.100
Protein coverage (%)	TK1151 95.905 / OH-1004 25.713 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G003440

Location Chr07:924894-927509 (-)

Description Similar to BRM: ATP-dependent helicase BRM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46020`	ATPase subunit of a multiprotein complex equivalent of the SWI/SNF complex that acts by remodeling the chromatin by catalyzing an ATP-dependent alteration in the structure of nucleosomal DNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026715 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

KEGG gene cross-reference

ath:AT2G28290

ath:AT2G46020

ath:AT3G06010

ath:AT5G19310

dosa:Os05g0144300

osa:4337784

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.825

Rank 1 · TkA07G003440 · TK1151

Cytoplasm0.278

Rank 2 · TkA07G003440 · TK1151

Cell membrane0.022

Rank 3 · TkA07G003440 · TK1151

Mitochondrion0.022

Rank 4 · TkA07G003440 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA07G003440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6EVK6`	Arabidopsis thaliana	sp\|Q6EVK6\|BRM_ARATH Chromatin remodeling ATPase BRAHMA	38.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card