TkA07G002700 | RubberDandelionOmics

Gene overview

TkA07G002700

Reference: TK1151 Chr: Chr07 Coordinates: 699246-703730 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2221 bp · TkA07G002700|TK1151|cDNA

GGGAGCTACAAGAAATAAATTAATATTTCAAGGACCTGCGTCGAAAAACAAACTTAGGTTTCGAAAAGAAGAACTATCTCTCTGTGTGTGTCTCTCTCTCTCCACTACTGCAAGTAGCGAACGAAAATGTCGACGACGGGGAAGAGAGATCTGGAAACCAGATCGCCGGCGACAATGTCCTACCGGAGCAATTCTTCACCACAGCCTACGCTTCCGTTGGTCGTCACTCTCAACTGCATCGAAGACACAACCATCGAACA...

CDS

Download CDS FASTA

1833 bp · TkA07G002700|TK1151|CDS

ATGTCGACGACGGGGAAGAGAGATCTGGAAACCAGATCGCCGGCGACAATGTCCTACCGGAGCAATTCTTCACCACAGCCTACGCTTCCGTTGGTCGTCACTCTCAACTGCATCGAAGACACAACCATCGAACAGGAATACCTGGCCGGCATCGCACGTGTGGAGCACGTACCTCTGAGCCTACTAGCAGAGGCGAAGATCGAGTCTGCTGCAGCTGTTCTTCTACACTCCCTCGCGTTTCTACCACGTGCTGCCCAGCG...

Protein

Download Protein FASTA

610 aa · TkA07G002700|TK1151|PROTEIN

MSTTGKRDLETRSPATMSYRSNSSPQPTLPLVVTLNCIEDTTIEQEYLAGIARVEHVPLSLLAEAKIESAAAVLLHSLAFLPRAAQRRLRPWQIVLCLGSSDRSVDSAIAADLGLGRLVHVDVSRAEEVADTVMALFLGLLRRTHLLSRHALSASGWLGSVQPLCRGMRRCRGLVLGIIGRSPSAKSLATRSLAFKISVLYHDVNEEKGKILSRFPPAARRMDTLNDLLAASDLISLHCALTNDTIQILSAEALQHVKPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G002700`
TK1151 ID	TkA07G002700
OH-1004 ID	LXL04_026702
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G002700

Location Chr07:699246-703730 (+)

Description Similar to AN: C-terminal binding protein AN

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01510`	Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026702 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007097 nuclear migration Biological Process

GO:0007219 Notch signaling pathway Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010091 trichome branching Biological Process

KEGG gene cross-reference

ath:AT1G01510

dme:Dmel_CG7583

mmu:13016

rno:29382

xla:398147

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.508

Rank 1 · TkA07G002700 · TK1151

Nucleus0.334

Rank 2 · TkA07G002700 · TK1151

Cell membrane0.149

Rank 3 · TkA07G002700 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA07G002700 · TK1151

Golgi apparatus0.069

Rank 5 · TkA07G002700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF028262-Hacid_dh_C134-314 aa

PF09531Ndc1_Nup322-450 aa

PF14857TMEM151364-475 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G002700	`PF02826`	2-Hacid_dh_C	134	314	1.2e-26	93.8
TkA07G002700	`PF09531`	Ndc1_Nup	322	450	1.2	8.5
TkA07G002700	`PF14857`	TMEM151	364	475	0.96	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23702`	Arabidopsis thaliana	sp\|O23702\|CTBP_ARATH C-terminal binding protein AN	60.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card