TkA07G001430 | RubberDandelionOmics

Gene overview

TkA07G001430

Reference: TK1151 Chr: Chr07 Coordinates: 364796-366196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · TkA07G001430|TK1151|cDNA

ATGGCAAGAACACCCCATATAGCCATTGTACCGAGTCCAGGCATGGGTCACTTAATCCCTTTAGTCGAATTCTCAAAAAGACTATTAAACAGCCATCAAATCACTGCAACTTTCATCATCCCAAATGATGGACCTTTATCCAAATCGCAAACAGCTTTTCTTGATTCTCTCCCAAATGGATTAAGCTACCTCCTTCTACCTCCGATCAAGTTCGATGATTTACCCCAAGATACCCAAATGGAAACTCGAATTAGCTTGAT...

CDS

Download CDS FASTA

1191 bp · TkA07G001430|TK1151|CDS

ATGGCAAGAACACCCCATATAGCCATTGTACCGAGTCCAGGCATGGGTCACTTAATCCCTTTAGTCGAATTCTCAAAAAGACTATTAAACAGCCATCAAATCACTGCAACTTTCATCATCCCAAATGATGGACCTTTATCCAAATCGCAAACAGCTTTTCTTGATTCTCTCCCAAATGGATTAAGCTACCTCCTTCTACCTCCGATCAAGTTCGATGATTTACCCCAAGATACCCAAATGGAAACTCGAATTAGCTTGAT...

Protein

Download Protein FASTA

396 aa · TkA07G001430|TK1151|PROTEIN

MARTPHIAIVPSPGMGHLIPLVEFSKRLLNSHQITATFIIPNDGPLSKSQTAFLDSLPNGLSYLLLPPIKFDDLPQDTQMETRISLMVTRSLPSLRHVFKSLVAEKHMVALFIDLFGTDAFDVAIEFGVSPYVFFPSTAMALSLFLHLPKLDQEVDCEYRELSEPVQIPGCIPVRGQDLLDPVQDRKNDAYKWVLHNAKRYMMAEGIAVNSFKELEGGALRVLLQEEPGKPMVYPVGPLIQAGSGSNLDGSDCLRWLDGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G001430`
TK1151 ID	TkA07G001430
OH-1004 ID	LXL04_022781
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.000
Protein coverage (%)	TK1151 88.889 / OH-1004 75.480 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G001430

Location Chr07:364796-366196 (+)

Description Similar to AS: Hydroquinone glucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01070`	Bifunctional O-glycosyltransferase and N-glycosyltransferase that can detoxify xenobiotics.	Functional importance of the family 1 glucosyltransferase UGT72B1 in the metabolism of xenobiotics in Arabidopsis thaliana.2005 · DOI: 10.1111/j.1365-313x.2005.02398.x Characterization and engineering of the bifunctional N- and O-glucosyltransferase involved in xenobiotic metabolism in plants.2007 · DOI: 10.1073/pnas.0706421104
`At1g01420`	Possesses low quercetin 3-O-glucosyltransferase activity in vitro.	No verified direct reference in this release
`At1g01390`	UDP-glycosyltransferase 72B2.	No verified direct reference in this release
`At5g66690`	Involved in the O-glucosylation of monolignols (alcohol monomers of lignin).	Arabidopsis glucosyltransferases with activities toward both endogenous and xenobiotic substrates.2003 · DOI: 10.1007/s00425-002-0969-0 Identification and characterisation of Arabidopsis glycosyltransferases capable of glucosylating coniferyl aldehyde and sinapyl aldehyde.2005 · DOI: 10.1016/j.febslet.2005.04.016 The glucosyltransferase UGT72E2 is responsible for monolignol 4-O-glucoside production in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1365-313x.2006.02872.x Enzymatic and metabolic engineering for efficient production of syringin, sinapyl alcohol 4-O-glucoside, in Arabidopsis thaliana.2014 · DOI: 10.1016/j.phytochem.2014.03.003

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022781 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006805 xenobiotic metabolic process Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0042178 xenobiotic catabolic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0047213 anthocyanidin 3-O-glucosyltransferase activity Molecular Function

GO:0050505 hydroquinone glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:CAC35167

ath:AT1G01390

ath:AT1G01420

ath:AT4G01070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.773

Rank 1 · TkA07G001430 · TK1151

Nucleus0.250

Rank 2 · TkA07G001430 · TK1151

Endoplasmic reticulum0.082

Rank 3 · TkA07G001430 · TK1151

Plastid0.060

Rank 4 · TkA07G001430 · TK1151

Peroxisome0.053

Rank 5 · TkA07G001430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N7-39 aa

PF26168Glyco_transf_N197-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G001430	`PF26168`	Glyco_transf_N	7	39	0.0022	18.6
TkA07G001430	`PF26168`	Glyco_transf_N	197	240	0.0022	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M156`	Arabidopsis thaliana	sp\|Q9M156\|U72B1_ARATH UDP-glycosyltransferase 72B1	52.200%	Swiss-Prot	High
`Q9LNI1`	Arabidopsis thaliana	sp\|Q9LNI1\|U72B3_ARATH UDP-glycosyltransferase 72B3	58.100%	Swiss-Prot	High
`Q8W4C2`	Arabidopsis thaliana	sp\|Q8W4C2\|U72B2_ARATH UDP-glycosyltransferase 72B2	55.900%	Swiss-Prot	High
`Q9LVR1`	Arabidopsis thaliana	sp\|Q9LVR1\|U72E2_ARATH UDP-glycosyltransferase 72E2	41.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card