TkA07G000420 | RubberDandelionOmics

Gene overview

TkA07G000420

Reference: TK1151 Chr: Chr07 Coordinates: 107986-108396 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA07G000420|TK1151|cDNA

AGAACCATTAGAAGCCCATCCGGGTTTAAACAAATCCATCCGGGTTTTGATTTTTCCATCCGGGTTTTTCCCATTCCGTCCGGGTTTTTTCCATTCCGTCCGGGTTTTGGGCCTTACCCTAATTTCTTCCCGGCCCAACGCTTAAATAACCTAAAACGCAGAAGATCGCCATTTTTTGGGGGAAACCTCTCTGGTTCGACCTCCGCTCCGCTCCGACCTCACCTCCGCTCCGACCACCACGCCGACGACCTCCACTCCGA...

CDS

Download CDS FASTA

411 bp · TkA07G000420|TK1151|CDS

AGAACCATTAGAAGCCCATCCGGGTTTAAACAAATCCATCCGGGTTTTGATTTTTCCATCCGGGTTTTTCCCATTCCGTCCGGGTTTTTTCCATTCCGTCCGGGTTTTGGGCCTTACCCTAATTTCTTCCCGGCCCAACGCTTAAATAACCTAAAACGCAGAAGATCGCCATTTTTTGGGGGAAACCTCTCTGGTTCGACCTCCGCTCCGCTCCGACCTCACCTCCGCTCCGACCACCACGCCGACGACCTCCACTCCGA...

Protein

Download Protein FASTA

136 aa · TkA07G000420|TK1151|PROTEIN

RTIRSPSGFKQIHPGFDFSIRVFPIPSGFFPFRPGFGPYPNFFPAQRLNNLKRRRSPFFGGNLSGSTSAPLRPHLRSDHHADDLHSDASSALLRPPFRRDLHANDLDDQLHFSLFFSRALFQTQYQLNVQGPRSCN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G000420`
TK1151 ID	TkA07G000420
OH-1004 ID	LXL04_013587
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.800
Protein coverage (%)	TK1151 32.353 / OH-1004 16.117 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G000420`
Location	Chr07:107986-108396 (+)
Description	Similar to ORC1B: Origin of replication complex subunit 1B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013587` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0006270 DNA replication initiation Biological Process GO:0006277 DNA amplification Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009567 double fertilization forming a zygote and endosperm Biological Process GO:0009744 response to sucrose Biological Process GO:0033314 mitotic DNA replication checkpoint signaling Biological Process GO:0048661 positive regulation of smooth muscle cell proliferation Biological Process GO:0070318 positive regulation of G0 to G1 transition Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0000808 origin recognition complex Cellular Component
KEGG gene cross-reference	ath:AT4G12620 ath:AT4G14700 dme:Dmel_CG10667 dosa:Os06g0187000 rno:313479 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.590

Rank 1 · TkA07G000420 · TK1151

Cytoplasm0.454

Rank 2 · TkA07G000420 · TK1151

Mitochondrion0.059

Rank 3 · TkA07G000420 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA07G000420 · TK1151

Cell membrane0.043

Rank 5 · TkA07G000420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29340RsmA_N61-84 aa

PF29340RsmA_N100-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G000420	`PF29340`	RsmA_N	61	84	0.13	13.4
TkA07G000420	`PF29340`	RsmA_N	100	109	0.13	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card