TkA06G476300 | RubberDandelionOmics

Gene overview

TkA06G476300

Reference: TK1151 Chr: Chr06 Coordinates: 118049592-118050633 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

965 bp · TkA06G476300|TK1151|cDNA

GAAAATCCAGTCGTCATCATAATCTTTAACTCACCAAATAAATCCAAAAACATTCTTGTCCTTACAAACAATACAAACACACATTTCTTCTTCCTCTTCCTCTTTCTCTTTCTCTTCAACAGCATCATCTCTTTTGGATTCATGGATGCTTCTCAATGGAAACTGGAAGCTGTTAATAATAGTAATAACATTCAAGTAGATGTTGAGAGGAAGGTAAGGCCCCAAGAACAACAAGCTCTGAACTGCCCAAGATGCAAGTC...

CDS

Download CDS FASTA

735 bp · TkA06G476300|TK1151|CDS

GAAAATCCAGTCGTCATCATAATCTTTAACTCACCAAATAAATCCAAAAACATTCTTGTCCTTACAAACAATACAAACACACATTTCTTCTTCCTCTTCCTCTTTCTCTTTCTCTTCAACAGCATCATCTCTTTTGGATTCATGGATGCTTCTCAATGGAAACTGGAAGCTGTTAATAATAGTAATAACATTCAAGTAGATGTTGAGAGGAAGGTAAGGCCCCAAGAACAACAAGCTCTGAACTGCCCAAGATGCAAGTC...

Protein

Download Protein FASTA

244 aa · TkA06G476300|TK1151|PROTEIN

ENPVVIIIFNSPNKSKNILVLTNNTNTHFFFLFLFLFLFNSIISFGFMDASQWKLEAVNNSNNIQVDVERKVRPQEQQALNCPRCKSSNTKFCYYNNYSLTQPRYLCKSCRRYWTQGGSLRNVPVGGGSRKHKRSISSSTQNTTPHLNLSFQQQDHHHHNNGFSQFLKLPKIENSNNELNLFNSNSNPIFNVQVDGNGTKYGGFQEMMLPFGVMMNQQQFSSTREEGSQNVGSTGYWNSTFLGD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G476300`
TK1151 ID	TkA06G476300
OH-1004 ID	LXL04_021575
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.200
Protein coverage (%)	TK1151 36.885 / OH-1004 29.703 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G476300

Location Chr06:118049592-118050633 (+)

Description Similar to DOF4.6: Dof zinc finger protein DOF4.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46590`	Transcription factor specifically involved in the maternal control of seed germination.	No verified direct reference in this release
`At4g00940`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At1g64620`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At3g61850`	Transcription factor specifically involved in the maternal control of seed germination.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0567800`	Transcription factor that may transactivate seed storage protein genes in developing seeds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021575 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009845 seed germination Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT3G55370

ath:AT3G61850

ath:AT4G24060

ath:AT5G60200

dosa:Os04g0567800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · TkA06G476300 · TK1151

Cytoplasm0.088

Rank 2 · TkA06G476300 · TK1151

Cell membrane0.022

Rank 3 · TkA06G476300 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA06G476300 · TK1151

Plastid0.011

Rank 5 · TkA06G476300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06237SLC52_ribofla_tr23-81 aa

PF23451Zn_ribbon_PaaD73-111 aa

PF02701Zn_ribbon_Dof78-134 aa

PF12760Zn_ribbon_IS159580-112 aa

PF03811Zn_ribbon_InsA81-111 aa

PF27208TP_021482-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G476300	`PF06237`	SLC52_ribofla_tr	23	81	0.053	13.3
TkA06G476300	`PF23451`	Zn_ribbon_PaaD	73	111	0.0026	18.1
TkA06G476300	`PF02701`	Zn_ribbon_Dof	78	134	1.7e-33	115.3
TkA06G476300	`PF12760`	Zn_ribbon_IS1595	80	112	2.4	8.9
TkA06G476300	`PF03811`	Zn_ribbon_InsA	81	111	5.6	7.5
TkA06G476300	`PF27208`	TP_0214	82	112	0.076	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPY0`	Arabidopsis thaliana	sp\|Q9ZPY0\|DOF25_ARATH Dof zinc finger protein DOF2.5	78.700%	Swiss-Prot	Low
`Q9M161`	Arabidopsis thaliana	sp\|Q9M161\|DOF41_ARATH Dof zinc finger protein DOF4.1	53.100%	Swiss-Prot	Medium
`Q84JQ8`	Arabidopsis thaliana	sp\|Q84JQ8\|DOF18_ARATH Dof zinc finger protein DOF1.8	70.900%	Swiss-Prot	Low
`Q43385`	Arabidopsis thaliana	sp\|Q43385\|DOF37_ARATH Dof zinc finger protein DOF3.7	66.700%	Swiss-Prot	Low
`Q9SXG8`	Oryza sativa subsp. japonica	sp\|Q9SXG8\|DOF1_ORYSJ Dof zinc finger protein 1	80.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card