TkA06G476260 | RubberDandelionOmics

Gene overview

TkA06G476260

Reference: TK1151 Chr: Chr06 Coordinates: 118033008-118035346 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2236 bp · TkA06G476260|TK1151|cDNA

AGGGATTATAAACCTAACCATGGTTAACTCCCTTCACCCCCCTCTAACTTCATGCCACGGGTTTATAGTTTATACACGCGCAGTTCGGATTTAGGAACGAAAACCACAAGGCAAACTTCTCTCTCTCTCTCTCTCTCTCCCTAAAACCCAACAATTTCCTACAAAGTGAGGATTGTGTTTATCGTTTTATTCTCTGAAACAAGGATTCCGGATTTAGAGCATGGAGATCTGAAATTGGCAGGCACTTCCAGTTCAAGTGT...

CDS

Download CDS FASTA

1629 bp · TkA06G476260|TK1151|CDS

ATGAAACTAGAGGCGGCGAATATGGGCGGTGACAATTTTAATGATGAAGAGAAAGCGATTGTTGCGGCTGTTTTAGGAACTAGAGCATTCGATTACCTGATTTCCAGTTCCGCTGGTAATGAATGCTCATTAACTGCATTAGCGACCGATGATAGTTTACAAAACAAGCTCTCAGATCTCGTAGATAACCCTAATTCGGCTAATTTTAGTTGGAATTACGCTATTTTTTGGCAAATATCCCGCTCAAAGTCGGGAGATTT...

Protein

Download Protein FASTA

542 aa · TkA06G476260|TK1151|PROTEIN

MKLEAANMGGDNFNDEEKAIVAAVLGTRAFDYLISSSAGNECSLTALATDDSLQNKLSDLVDNPNSANFSWNYAIFWQISRSKSGDLVLVWADGSCREPREGEEFEIARILSIRLEDENQQRMKKRVLQNLHVLFGGLDEDNYAFGLDRVTDTEMFFLISMYFSFPQGQGGPGKCFSSGYHLWYSDALRSTSDYCFRSNLSKSAGIQTVVLLPTDAGVLEVGSIRSIPENMDLLHSIRSSFPSTPNNSLVSPILSKILNH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G476260`
TK1151 ID	TkA06G476260
OH-1004 ID	LXL04_022563
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G476260

Location Chr06:118033008-118035346 (-)

Description Similar to MTB1: Transcription factor MTB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01260`	Transcription factor bHLH13.	No verified direct reference in this release
`At2g46510`	Transcription activator.	No verified direct reference in this release
`At4g16430`	Transcription factor bHLH3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022563 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0031347 regulation of defense response Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G01260

ath:AT2G46510

ath:AT4G16430

sly:101247327

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.872

Rank 1 · TkA06G476260 · TK1151

Cytoplasm0.176

Rank 2 · TkA06G476260 · TK1151

Cell membrane0.057

Rank 3 · TkA06G476260 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA06G476260 · TK1151

Plastid0.017

Rank 5 · TkA06G476260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215bHLH-MYC_N53-241 aa

PF21048Rad26-like_N240-257 aa

PF23181bHLH_INO4399-433 aa

PF00010HLH400-446 aa

PF23177bHLH_IRO3403-458 aa

PF23173bHLH_SAC51405-448 aa

PF22754bHLH-TF_ACT-like_plant465-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G476260	`PF14215`	bHLH-MYC_N	53	241	2e-51	175.6
TkA06G476260	`PF21048`	Rad26-like_N	240	257	0.14	12.7
TkA06G476260	`PF23181`	bHLH_INO4	399	433	0.077	13.8
TkA06G476260	`PF00010`	HLH	400	446	3e-12	46.9
TkA06G476260	`PF23177`	bHLH_IRO3	403	458	4e-09	37.4
TkA06G476260	`PF23173`	bHLH_SAC51	405	448	0.0013	19.3
TkA06G476260	`PF22754`	bHLH-TF_ACT-like_plant	465	533	0.00012	22.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNJ5`	Arabidopsis thaliana	sp\|Q9LNJ5\|BH013_ARATH Transcription factor bHLH13	48.900%	Swiss-Prot	Medium
`Q9ZPY8`	Arabidopsis thaliana	sp\|Q9ZPY8\|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE	46.200%	Swiss-Prot	Medium
`O23487`	Arabidopsis thaliana	sp\|O23487\|BH003_ARATH Transcription factor bHLH3	36.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card