TkA06G474620 | RubberDandelionOmics

Gene overview

TkA06G474620

Reference: TK1151 Chr: Chr06 Coordinates: 117551259-117551852 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

594 bp · TkA06G474620|TK1151|cDNA

ATGCCTTACATCTCCCCTTATTCAGACTTCTCTTCTTTAAGACCCGGAAGTGCTGAAAAGGAAAAACACGCGTGTGCAGTTGTACACGAGATGCTGAGTCTTATGGTTGAAAAAAGAACCTTAGTTGACCATTTGACTCATTTTCGTGAAGAGTTTAGATTCTCTCAACAACTTAGAGGGATGCTTATAAGACACCCGGACATGTTTTATGTTTCTTTGAAAGGAGACCGCGATTCTGTGTTCTTGAGAGACGCGTATCG...

CDS

Download CDS FASTA

594 bp · TkA06G474620|TK1151|CDS

ATGCCTTACATCTCCCCTTATTCAGACTTCTCTTCTTTAAGACCCGGAAGTGCTGAAAAGGAAAAACACGCGTGTGCAGTTGTACACGAGATGCTGAGTCTTATGGTTGAAAAAAGAACCTTAGTTGACCATTTGACTCATTTTCGTGAAGAGTTTAGATTCTCTCAACAACTTAGAGGGATGCTTATAAGACACCCGGACATGTTTTATGTTTCTTTGAAAGGAGACCGCGATTCTGTGTTCTTGAGAGACGCGTATCG...

Protein

Download Protein FASTA

197 aa · TkA06G474620|TK1151|PROTEIN

MPYISPYSDFSSLRPGSAEKEKHACAVVHEMLSLMVEKRTLVDHLTHFREEFRFSQQLRGMLIRHPDMFYVSLKGDRDSVFLRDAYRDSQLVDKNRLLIIKEKLRALVSVPRFRSRGGVAKSDVDSDGGDEEDEVEEEDWSDLDELVSNEMDDDDDMPPDFDEDDGSVKMSRRKEGNGDEEEVCDPVFPDGKPRERW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G474620`
TK1151 ID	TkA06G474620
OH-1004 ID	LXL04_022581
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.900
Protein coverage (%)	TK1151 100.000 / OH-1004 40.041 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G474620

Location Chr06:117551259-117551852 (+)

Description Similar to At4g01037: Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01037`	RNA-binding protein involved in group II intron splicing.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0571100`	RNA-binding protein involved in group II intron splicing.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022581 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0015979 photosynthesis Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G39120

ath:AT4G01037

ath:AT4G33495

dosa:Os05g0571100

osa:4339664

zma:100277394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · TkA06G474620 · TK1151

Cytoplasm0.136

Rank 2 · TkA06G474620 · TK1151

Cell membrane0.037

Rank 3 · TkA06G474620 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA06G474620 · TK1151

Plastid0.019

Rank 5 · TkA06G474620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11955PORR1-109 aa

PF22916UTP25_NTPase-like22-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G474620	`PF11955`	PORR	1	109	4.7e-45	154.7
TkA06G474620	`PF22916`	UTP25_NTPase-like	22	81	0.18	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0MFS5`	Arabidopsis thaliana	sp\|A0MFS5\|WTF1_ARATH Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic	65.400%	Swiss-Prot	High
`Q65XL5`	Oryza sativa subsp. japonica	sp\|Q65XL5\|WTF1_ORYSJ Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic	57.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card