TkA06G474270 | RubberDandelionOmics

Gene overview

TkA06G474270

Reference: TK1151 Chr: Chr06 Coordinates: 117461153-117465047 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1908 bp · TkA06G474270|TK1151|cDNA

CTGACTTGCCACATGTCACTCATTCATTGGAACCTTTCTCAATTTTCCTTCCACCTCAGCATGCCCACCCATATTACACCCTCCAGATTCCAGAACAAACCAGAAATTAATCGACATTCTCATGGTGATTAACCAACTCTCATCAATCTGTTCTTGAGCACTTTTACACCGACGATTATGCTATGGAAGCTCTCAATGCAGTTGTGTTAAAACCAATTTCTGTTTTAAAACCAGAACCCAAGAAACACTCACCGTTCCCC...

CDS

Download CDS FASTA

1374 bp · TkA06G474270|TK1151|CDS

ATGGAAGCTCTCAATGCAGTTGTGTTAAAACCAATTTCTGTTTTAAAACCAGAACCCAAGAAACACTCACCGTTCCCCACTATTCAACATCTCAAAATCTCAAAACCCCAGTTCCATGGAAGTAGTTTAGTGCTTATATCCTCCGTATTCAACTCTGCTTTCGCAAAAGCACTTACGTACGAAGAAGCACTCAGTCAATCAACAACAGCTTCCGACTCCTCATTCTCAGCACCTGATTTAGATATCAGCAGTGTTCTCGA...

Protein

Download Protein FASTA

457 aa · TkA06G474270|TK1151|PROTEIN

MEALNAVVLKPISVLKPEPKKHSPFPTIQHLKISKPQFHGSSLVLISSVFNSAFAKALTYEEALSQSTTASDSSFSAPDLDISSVLDGIINFGVENPLVLAGGAAALALPAILSQVFGKSKPWGVETARVAYEKLGDDGNAELLDIRPASEIRTGGSPDIRGLKKKPIRVAYNGDDKPGFLKKLALKFKEPENTTLFILDKFDGSSELVAELVTVNGFKAAYAIKDGAEGPRGWANSSLPWILPQKSFAFDLSGVTDAFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G474270`
TK1151 ID	TkA06G474270
OH-1004 ID	LXL04_036693
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	36.500
Protein coverage (%)	TK1151 36.105 / OH-1004 48.083 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G474270

Location Chr06:117461153-117465047 (-)

Description Similar to STR4A: Rhodanese-like domain-containing protein 4A, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01050`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	Tethering of ferredoxin:NADP+ oxidoreductase to thylakoid membranes is mediated by novel chloroplast protein TROL.2009 · DOI: 10.1111/j.1365-313x.2009.03999.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0257300`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	No verified direct reference in this release
`UniProt: A2X345`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036693 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0098807 chloroplast thylakoid membrane protein complex Cellular Component

KEGG gene cross-reference

ath:AT3G25480

ath:AT4G01050

dosa:Os02g0257300

osa:4328925

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.985

Rank 1 · TkA06G474270 · TK1151

Mitochondrion0.021

Rank 2 · TkA06G474270 · TK1151

Cytoplasm0.015

Rank 3 · TkA06G474270 · TK1151

Nucleus0.015

Rank 4 · TkA06G474270 · TK1151

Cell membrane0.010

Rank 5 · TkA06G474270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30980STR4_M123-248 aa

PF00581Rhodanese132-229 aa

PF28616STR4_N300-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G474270	`PF30980`	STR4_M	123	248	8.9e-64	213.7
TkA06G474270	`PF00581`	Rhodanese	132	229	0.041	15.0
TkA06G474270	`PF28616`	STR4_N	300	326	3.8e-14	52.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M158`	Arabidopsis thaliana	sp\|Q9M158\|STR4_ARATH Rhodanese-like domain-containing protein 4, chloroplastic	55.200%	Swiss-Prot	High
`Q6ETQ7`	Oryza sativa subsp. japonica	sp\|Q6ETQ7\|TROL_ORYSJ Protein THYLAKOID RHODANESE-LIKE, chloroplastic	46.900%	Swiss-Prot	Medium
`A2X345`	Oryza sativa subsp. indica	sp\|A2X345\|TROL_ORYSI Protein THYLAKOID RHODANESE-LIKE, chloroplastic	47.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card