RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G472950
Reference: TK1151 Chr: Chr06 Coordinates: 116968946-116969437 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

492 bp · TkA06G472950|TK1151|cDNA

ATGGATATCTTGATGAATCCTGCGAAAACAAGTTTTTCAGCATATGTCGAGTACATATTCATTCTACTTTGTTTCATCCAGGACACTTTTCTATCAGTATTATGTCTTATCGGTATCTCTAAACCTATCGAGTTCCACCACCTCCACCACCCAAAAAAACCAGAAAACTCTCCTATTTCAGCAGTTTTGACTCGAGAATTCCTCGTGACCAGTAAATGTAAGGACGTTTTGGGAAATAATTCATCGAAAGACTGTGCAAT...

CDS

Download CDS FASTA

492 bp · TkA06G472950|TK1151|CDS

ATGGATATCTTGATGAATCCTGCGAAAACAAGTTTTTCAGCATATGTCGAGTACATATTCATTCTACTTTGTTTCATCCAGGACACTTTTCTATCAGTATTATGTCTTATCGGTATCTCTAAACCTATCGAGTTCCACCACCTCCACCACCCAAAAAAACCAGAAAACTCTCCTATTTCAGCAGTTTTGACTCGAGAATTCCTCGTGACCAGTAAATGTAAGGACGTTTTGGGAAATAATTCATCGAAAGACTGTGCAAT...

Protein

Download Protein FASTA

163 aa · TkA06G472950|TK1151|PROTEIN

MDILMNPAKTSFSAYVEYIFILLCFIQDTFLSVLCLIGISKPIEFHHLHHPKKPENSPISAVLTREFLVTSKCKDVLGNNSSKDCAICLDEFKGEDEIRCLTNCKHMFHLNCLDRWMDQIQDTCPLCRIPILPLACQDEYKERLRCVTNLNNSYRQDFVILGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G472950
TK1151 IDTkA06G472950
OH-1004 IDLXL04_022621
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 98.773 / OH-1004 53.135
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G472950
LocationChr06:116968946-116969437 (-)
DescriptionSimilar to BRH1: Brassinosteroid-responsive RING protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g61460 May be involved in the brassinosteroids (BRs) signaling pathway and regulate the growth and development of rosette leaves.
Characterisation of BRH1, a brassinosteroid-responsive RING-H2 gene from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-001-0723-z
Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.2018 · DOI: 10.1007/s11427-017-9133-8
At2g01150 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development.
The Arabidopsis RING finger E3 ligase RHA2b acts additively with RHA2a in regulating abscisic acid signaling and drought response.2011 · DOI: 10.1104/pp.111.176214
At5g43420 RING-H2 finger protein ATL16. No verified direct reference in this release
At4g15975 May be involved in the early steps of the plant defense signaling pathway. No verified direct reference in this release
At2g42360 E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8, UBC10, UBC11, UBC28, UBC29, UBC30, UBC35 and UBC36 in vitro. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022621 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010200 response to chitin Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0047484 regulation of response to osmotic stress Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:1901371 regulation of leaf morphogenesis Biological Process
GO:1905421 regulation of plant organ morphogenesis Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G23980
ath:AT2G01150
ath:AT2G35420
ath:AT3G18930
ath:AT3G61460
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.296
Rank 1 · TkA06G472950 · TK1151
Lysosome / Vacuole0.240
Rank 2 · TkA06G472950 · TK1151
Cytoplasm0.223
Rank 3 · TkA06G472950 · TK1151
Cell membrane0.194
Rank 4 · TkA06G472950 · TK1151
Nucleus0.176
Rank 5 · TkA06G472950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14835zf-RING_616-32 aa
PF17120zf-RING_1663-77 aa
PF17032Zn_ribbon_1565-94 aa
PF14835zf-RING_667-80 aa
PF14447Prok-RING_471-91 aa
PF27846tSAM_targ_Cxxx_rpt71-124 aa
PF13832zf-HC5HC2H_272-114 aa
PF13771zf-HC5HC2H72-115 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G472950PF14835zf-RING_616320.02914.9
TkA06G472950PF17120zf-RING_1663770.002318.2
TkA06G472950PF17032Zn_ribbon_1565947.78.1
TkA06G472950PF14835zf-RING_667800.02914.9
TkA06G472950PF14447Prok-RING_471910.9510.1
TkA06G472950PF27846tSAM_targ_Cxxx_rpt711243.28.5
TkA06G472950PF13832zf-HC5HC2H_2721140.02515.5
TkA06G472950PF13771zf-HC5HC2H721150.6910.9
TkA06G472950PF29452FAR1_N76970.212.4
TkA06G472950PF14446Prok-RING_1791150.0002621.8
TkA06G472950PF08746zf-RING-like79880.2412.3
TkA06G472950PF17120zf-RING_16811250.002318.2
TkA06G472950PF13920zf-C3HC4_3821310.0006520.2
TkA06G472950PF29452FAR1_N821290.212.4
TkA06G472950PF22908PHD_NSD831240.1313.3
TkA06G472950PF13639zf-RING_2841282.1e-1247.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9XF92Arabidopsis thalianasp|Q9XF92|BRH1_ARATH Brassinosteroid-responsive RING protein 140.700%Swiss-ProtMedium
Q9ZU51Arabidopsis thalianasp|Q9ZU51|RHA2B_ARATH E3 ubiquitin-protein ligase RHA2B43.600%Swiss-ProtLow
Q9LSW9Arabidopsis thalianasp|Q9LSW9|ATL16_ARATH RING-H2 finger protein ATL1646.800%Swiss-ProtLow
Q8LF65Arabidopsis thalianasp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL1746.200%Swiss-ProtLow
Q9SLC3Arabidopsis thalianasp|Q9SLC3|ATL41_ARATH E3 ubiquitin-protein ligase ATL4145.300%Swiss-ProtLow

JBrowse

View in Genome Browser