TkA06G472280 | RubberDandelionOmics

Gene overview

TkA06G472280

Reference: TK1151 Chr: Chr06 Coordinates: 116788025-116789810 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA06G472280|TK1151|cDNA

ATGCAGGTGGATTTAGTAGGCGTATACTACGATGCCGGAGACAACGTCAAGTTTGGGTTTCCGATGGCCTTCACCACCACAATGCTGTCGTGGAGTGTGATTGAATTTGGTGGGATGATTGAGTGGGTGATGCAACCACGGATCATGCGTGTTGGGAGAGACCTGAAGACATGTACACCATCTGTTTGTGGAAATGTCTTCCTGCGCCTGACCCTTGGAGAAGATATAAAACAAAACAAGGTCCTGGTTCAGCTTGGAGA...

CDS

Download CDS FASTA

432 bp · TkA06G472280|TK1151|CDS

ATGCAGGTGGATTTAGTAGGCGTATACTACGATGCCGGAGACAACGTCAAGTTTGGGTTTCCGATGGCCTTCACCACCACAATGCTGTCGTGGAGTGTGATTGAATTTGGTGGGATGATTGAGTGGGTGATGCAACCACGGATCATGCGTGTTGGGAGAGACCTGAAGACATGTACACCATCTGTTTGTGGAAATGTCTTCCTGCGCCTGACCCTTGGAGAAGATATAAAACAAAACAAGGTCCTGGTTCAGCTTGGAGA...

Protein

Download Protein FASTA

143 aa · TkA06G472280|TK1151|PROTEIN

MQVDLVGVYYDAGDNVKFGFPMAFTTTMLSWSVIEFGGMIEWVMQPRIMRVGRDLKTCTPSVCGNVFLRLTLGEDIKQNKVLVQLGDILDRGENVTNLFSTFMQAYGAHMCDYVEKDGKNIRGLENFKLEGEEHSVFGFTNET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G472280`
TK1151 ID	TkA06G472280
OH-1004 ID	LXL04_007840
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.100
Protein coverage (%)	TK1151 70.629 / OH-1004 61.677 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G472280

Location Chr06:116788025-116789810 (-)

Description Similar to At4g02290: Endoglucanase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02290`	Endoglucanase 17.	No verified direct reference in this release
`At1g02800`	Endoglucanase 1.	No verified direct reference in this release
`At1g23210`	Endoglucanase 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0443300`	Endoglucanase 11.	No verified direct reference in this release
`Os01g0312800`	Endoglucanase 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007840 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007389 pattern specification process Biological Process

GO:0009624 response to nematode Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:1990059 fruit valve development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02800

ath:AT4G02290

ath:AT4G39010

dosa:Os02g0123700

dosa:Os04g0443300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.348

Rank 1 · TkA06G472280 · TK1151

Cytoplasm0.264

Rank 2 · TkA06G472280 · TK1151

Nucleus0.116

Rank 3 · TkA06G472280 · TK1151

Mitochondrion0.104

Rank 4 · TkA06G472280 · TK1151

Lysosome / Vacuole0.090

Rank 5 · TkA06G472280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759Glyco_hydro_92-42 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G472280	`PF00759`	Glyco_hydro_9	2	42	5.9e-15	56.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81416`	Arabidopsis thaliana	sp\|O81416\|GUN17_ARATH Endoglucanase 17	77.800%	Swiss-Prot	Low
`Q9SRX3`	Arabidopsis thaliana	sp\|Q9SRX3\|GUN1_ARATH Endoglucanase 1	80.500%	Swiss-Prot	Low
`O49296`	Arabidopsis thaliana	sp\|O49296\|GUN4_ARATH Endoglucanase 4	49.400%	Swiss-Prot	Medium
`Q7XTH4`	Oryza sativa subsp. japonica	sp\|Q7XTH4\|GUN11_ORYSJ Endoglucanase 11	67.300%	Swiss-Prot	Low
`Q8LQ92`	Oryza sativa subsp. japonica	sp\|Q8LQ92\|GUN3_ORYSJ Endoglucanase 3	66.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card