TkA06G466180 | RubberDandelionOmics

Gene overview

TkA06G466180

Reference: TK1151 Chr: Chr06 Coordinates: 115338551-115342410 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1958 bp · TkA06G466180|TK1151|cDNA

TAAGGAATGAATGATTGGCCTTTTTCAGGTTTACACACCTTTGACCAGAGGGAGAGAGATTTGGTTTAGAGAGAGAGAGAGAGAGAGAGAGAAGGAGAGAAACACAGAGATTTAGAGAGAGAAAGTTGAAGAAGAAGGTGGGGGAGGGTTGCGTGTGGTGTCGCGAGTTCCTCCTCCCCGGCGGTGGTGGTGAAAGAGTGATTGAAGTTTGGGAGGTTTTAGAGAAAGTGTGATTTCTAGTTCTAGAGAGAGAAAGGGTG...

CDS

Download CDS FASTA

1401 bp · TkA06G466180|TK1151|CDS

ATGAATGTGATGCGTCGTCTGAAGAGTATCGCTTCTGGTCGTTCGTCCGTTTCAGATCCTGGTGGAGATTCCAGCATTAAAAGAGTAAAAGTCGAGCAAGAAGTAGAATCACATGTTATTGATGAACCACAATCAGTAGAAAAGACTACCACGAGTGTAGAACAGCAGCCCATGGATGCTACTGCCGAAATGTCTGCAAGTACATCCAACACATCTTCTATTCCAAAACCTGAAAAATCCGACTATGACGAGCTTCCAAA...

Protein

Download Protein FASTA

466 aa · TkA06G466180|TK1151|PROTEIN

MNVMRRLKSIASGRSSVSDPGGDSSIKRVKVEQEVESHVIDEPQSVEKTTTSVEQQPMDATAEMSASTSNTSSIPKPEKSDYDELPKEMHEMKIKEDKSEDKEIEATVVNGNGPEKGQVIVTTVGGRNGQPKQTLSYMAERVVGTGSFGVVFEAKCLETGESVAIKKVLQDKRYKNRELQIMRLLDHPNVVPLKNCFYSTTEKNEVYLNVVLEYVPETVYRVSRHYSRMTHQIPLIYVQLYTYQICRALNYIHSVIGVCH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G466180`
TK1151 ID	TkA06G466180
OH-1004 ID	LXL04_022681
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G466180

Location Chr06:115338551-115342410 (+)

Description Similar to ASK8: Shaggy-related protein kinase theta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00720`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At5g14640`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At5g26751`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At3g05840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022681 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0016310 phosphorylation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G05840

ath:AT4G00720

ath:AT5G14640

ath:AT5G26751

bna:106388722

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.752

Rank 1 · TkA06G466180 · TK1151

Cytoplasm0.375

Rank 2 · TkA06G466180 · TK1151

Cell membrane0.039

Rank 3 · TkA06G466180 · TK1151

Mitochondrion0.035

Rank 4 · TkA06G466180 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA06G466180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01633Choline_kinase37-94 aa

PF14531Kinase-like128-180 aa

PF03109ABC1130-167 aa

PF00069Pkinase138-421 aa

PF07714PK_Tyr_Ser-Thr140-335 aa

PF01636APH176-222 aa

PF05445Pox_ser-thr_kin215-279 aa

PF14531Kinase-like240-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G466180	`PF01633`	Choline_kinase	37	94	0.0067	16.5
TkA06G466180	`PF14531`	Kinase-like	128	180	0.016	15.2
TkA06G466180	`PF03109`	ABC1	130	167	1.8e-05	24.8
TkA06G466180	`PF00069`	Pkinase	138	421	1.3e-61	209.0
TkA06G466180	`PF07714`	PK_Tyr_Ser-Thr	140	335	1.1e-23	84.6
TkA06G466180	`PF01636`	APH	176	222	0.1	13.1
TkA06G466180	`PF05445`	Pox_ser-thr_kin	215	279	0.041	13.6
TkA06G466180	`PF14531`	Kinase-like	240	327	0.016	15.2
TkA06G466180	`PF01633`	Choline_kinase	242	283	0.0067	16.5
TkA06G466180	`PF03109`	ABC1	244	288	1.8e-05	24.8
TkA06G466180	`PF01636`	APH	256	283	0.1	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96287`	Arabidopsis thaliana	sp\|Q96287\|KSG8_ARATH Shaggy-related protein kinase theta	74.900%	Swiss-Prot	High
`Q8VZD5`	Arabidopsis thaliana	sp\|Q8VZD5\|KSG5_ARATH Shaggy-related protein kinase epsilon	79.700%	Swiss-Prot	High
`P43288`	Arabidopsis thaliana	sp\|P43288\|KSG1_ARATH Shaggy-related protein kinase alpha	79.400%	Swiss-Prot	High
`P43289`	Arabidopsis thaliana	sp\|P43289\|KSG3_ARATH Shaggy-related protein kinase gamma	78.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card