TkA06G465970 | RubberDandelionOmics

Gene overview

TkA06G465970

Reference: TK1151 Chr: Chr06 Coordinates: 115299589-115301137 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1279 bp · TkA06G465970|TK1151|cDNA

AAATTTCTGGCCCCAGATTTCTCTCACCCCAAAATAATTTGACTTTTGTTCTAAAAAAGGTAAATCAGATCACCTTCCCCGATTTTCGTCACCCCAAAATAGAATATTCATACCTTAACAATCGTATAACAAATTTGGATCGTCATCACGAGCTCAAAAGATGGACCAGAAAAACAAAAAGTCAAAAAAACCAACATATTCAAAATTCTCACAACAAGAACTTCCGGCATGGAAACCGATCTTAACCCCAGGATGGGTGA...

CDS

Download CDS FASTA

1002 bp · TkA06G465970|TK1151|CDS

ATGGACCAGAAAAACAAAAAGTCAAAAAAACCAACATATTCAAAATTCTCACAACAAGAACTTCCGGCATGGAAACCGATCTTAACCCCAGGATGGGTGATCACATCATTCATAACAATTGGTGCACTTTTCATCCCGGCCGGGCTTTTAGCCCTTGCGGCATCGGACAGTGTGGTGGAAATTGTTGACCGTTATGATGAAGGTTGTATCCCCGATGCCTATAGCCAAAAAGCTGAGTCATATATTCAAAACCCTAACGA...

Protein

Download Protein FASTA

333 aa · TkA06G465970|TK1151|PROTEIN

MDQKNKKSKKPTYSKFSQQELPAWKPILTPGWVITSFITIGALFIPAGLLALAASDSVVEIVDRYDEGCIPDAYSQKAESYIQNPNEKKTCVRTLRVPKKMVAPIFVYYQLENFYQNHRRFVKSKSDKQLRDANAQDDTHSCFPEDHTADNKPIVPCGLIAWSLFNDTYKLSARGKAIDIDKKGIAWKSDKEAKFGSDVYPKNFQKGALIGGGKLDERIPLSEQEDLIVWMRTAALPTFRKLYGKINTDLDAHETITAEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G465970`
TK1151 ID	TkA06G465970
OH-1004 ID	LXL04_022684
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G465970

Location Chr06:115299589-115301137 (-)

Description Similar to ALIS3: ALA-interacting subunit 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54320`	Required for the lipid transport activity of the ALA/ALIS P4-ATPase complex.	No verified direct reference in this release
`At3g12740`	Required for the lipid transport activity of the ALA/ALIS P4- ATPase complex.	The Arabidopsis P4-ATPase ALA3 localizes to the golgi and requires a beta-subunit to function in lipid translocation and secretory vesicle formation.2008 · DOI: 10.1105/tpc.107.054767
`At1g79450`	Required for the lipid transport activity of the ALA/ALIS P4-ATPase complex.	No verified direct reference in this release
`At1g16360`	Putative ALA-interacting subunit 4.	No verified direct reference in this release
`At5g46150`	Putative ALA-interacting subunit 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022684 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015914 phospholipid transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G16360

ath:AT1G54320

ath:AT1G79450

ath:AT3G12740

ath:AT5G46150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.406

Rank 1 · TkA06G465970 · TK1151

Cytoplasm0.311

Rank 2 · TkA06G465970 · TK1151

Golgi apparatus0.300

Rank 3 · TkA06G465970 · TK1151

Lysosome / Vacuole0.171

Rank 4 · TkA06G465970 · TK1151

Endoplasmic reticulum0.159

Rank 5 · TkA06G465970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03381CDC5052-318 aa

PF19774DUF6260246-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G465970	`PF03381`	CDC50	52	318	2.1e-89	300.5
TkA06G465970	`PF19774`	DUF6260	246	300	0.014	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLK2`	Arabidopsis thaliana	sp\|Q9SLK2\|ALIS3_ARATH ALA-interacting subunit 3	64.400%	Swiss-Prot	High
`Q9LTW0`	Arabidopsis thaliana	sp\|Q9LTW0\|ALIS1_ARATH ALA-interacting subunit 1	64.500%	Swiss-Prot	High
`Q8L8W0`	Arabidopsis thaliana	sp\|Q8L8W0\|ALIS5_ARATH ALA-interacting subunit 5	63.600%	Swiss-Prot	High
`Q9SA35`	Arabidopsis thaliana	sp\|Q9SA35\|ALIS4_ARATH Putative ALA-interacting subunit 4	63.000%	Swiss-Prot	High
`Q67YS6`	Arabidopsis thaliana	sp\|Q67YS6\|ALIS2_ARATH Putative ALA-interacting subunit 2	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card