Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2554 bp · TkA06G465960|TK1151|cDNA
CGAGTCTGACATAATTCTTCTTCCAGAAATCGATTTGAAAAAAAATCAATAATTTTTTTTTTAATTTTTGAATGCTCTCATTCTCGTCTGTCGGCATCCGCTTAAGCTCGATCGCCTTCCTCACGGGTAAACCCTTTTGTTTTATACAAATTTCTAATCCGTTTTCGTATCTCACTTCTCACTTCTCAGTTTCAAGATTCTCAAAGATTTATTTTTGTTATTTTCCGTTACATTGTTAATAATGCATTCATGTGTCGCTC...
1683 bp · TkA06G465960|TK1151|CDS
ATGGTAGAAGATCACGATAAAGAGAAAGAGGTCACGGTTGACTTTTGGTCAACCGAAGAATGGCTGTCCCATGCAAAAGATCTTGTACCACTGGCTCTCGAAAAGGCCCGAAAAGTTAACGGGTTTCCAGGCAGGTGGAAAATGATCATATCAAAATTAGAACAAATCCCGACTCGATTATCAGATTTATCAAGCCATCCGTGTTTTTCAAAGAACACATTATGCAAAGAACAACTTCAATCGGTTTCAAAAACATTAAA...
Protein
Download Protein FASTA560 aa · TkA06G465960|TK1151|PROTEIN
MVEDHDKEKEVTVDFWSTEEWLSHAKDLVPLALEKARKVNGFPGRWKMIISKLEQIPTRLSDLSSHPCFSKNTLCKEQLQSVSKTLNEIIKMAEKCLKEKQEGKLQMQSDLDALSGKIDLNLRDCGLLIKTGVLSEVALLTCTLTAPEGTSHGSCSVTELLARLQIGHLDAKHKALDCLVDVMKEDEKTVLPFLGRSSISALVQLLTATSPRIRETTVTLICTLTESGGCDDLLVSEGVLPPLIRLLESGSSVGREKSAI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G465960 |
|---|---|
| TK1151 ID | TkA06G465960 |
| OH-1004 ID | LXL04_022685 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 96.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G465960 |
|---|---|
| Location | Chr06:115291909-115297433 (+) |
| Description | Similar to VAC8: Vacuolar protein 8 (Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0016567 protein ubiquitination Biological Process GO:0034614 cellular response to reactive oxygen species Biological Process GO:0048364 root development Biological Process GO:0048658 anther wall tapetum development Biological Process GO:0071562 nucleus-vacuole junction assembly Biological Process GO:1904821 chloroplast disassembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0043495 protein-membrane adaptor activity Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function |
| KEGG gene cross-reference | ath:AT2G23140 ath:AT3G54790 kla:KLLA0_A11286g These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23005DUF703224-133 aaPF24768ARM_ARMC572-106 aaPF01133ER78-129 aaPF28415SIL1_FES1_HPBP1_C81-114 aaPF01602Adaptin_N81-101 aaPF19427Insc_C87-106 aaPF24714TOR1L1_N117-267 aaPF25151TPR_Trm732_C149-174 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G465960 | PF23005 | DUF7032 | 24 | 133 | 3.4e-38 | 130.7 |
| TkA06G465960 | PF24768 | ARM_ARMC5 | 72 | 106 | 8.3e-21 | 75.3 |
| TkA06G465960 | PF01133 | ER | 78 | 129 | 0.074 | 13.8 |
| TkA06G465960 | PF28415 | SIL1_FES1_HPBP1_C | 81 | 114 | 0.00021 | 21.5 |
| TkA06G465960 | PF01602 | Adaptin_N | 81 | 101 | 0.0059 | 16.0 |
| TkA06G465960 | PF19427 | Insc_C | 87 | 106 | 0.026 | 13.7 |
| TkA06G465960 | PF24714 | TOR1L1_N | 117 | 267 | 0.17 | 11.9 |
| TkA06G465960 | PF25151 | TPR_Trm732_C | 149 | 174 | 0.084 | 13.5 |
| TkA06G465960 | PF25598 | ARM_PUB | 158 | 269 | 1.9e-09 | 38.1 |
| TkA06G465960 | PF24768 | ARM_ARMC5 | 170 | 256 | 8.3e-21 | 75.3 |
| TkA06G465960 | PF13646 | HEAT_2 | 172 | 189 | 1.1e-06 | 29.5 |
| TkA06G465960 | PF01602 | Adaptin_N | 173 | 229 | 0.0059 | 16.0 |
| TkA06G465960 | PF00514 | Arm | 174 | 189 | 7.4e-33 | 112.2 |
| TkA06G465960 | PF25598 | ARM_PUB | 175 | 352 | 1.9e-09 | 38.1 |
| TkA06G465960 | PF00514 | Arm | 199 | 224 | 7.4e-33 | 112.2 |
| TkA06G465960 | PF24768 | ARM_ARMC5 | 199 | 374 | 8.3e-21 | 75.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.