TkA06G463790 | RubberDandelionOmics

Gene overview

TkA06G463790

Reference: TK1151 Chr: Chr06 Coordinates: 114777807-114778136 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · TkA06G463790|TK1151|cDNA

ATGGGGCATCCATTGACGTTCGAAACATTTGGTGATGTAATTCCCCCTCAGTACGCAATCCAAGTTCTAGATAAGTTAACCGGTGGGAATGCGATCATAACTACTGGTGTAGGGCAACTTCAGATGTGGGCCGCACAGTTCTACAAGTACAATAGACCTCGACAATGGCTGACCTCCGTTGGGACAGGGGCCATGGGGTTCGGGCTACCTGCAGCCATGGGCGCATCTCTCGCAAAGCCTGATGAAGTCATCATTGACAC...

CDS

Download CDS FASTA

330 bp · TkA06G463790|TK1151|CDS

ATGGGGCATCCATTGACGTTCGAAACATTTGGTGATGTAATTCCCCCTCAGTACGCAATCCAAGTTCTAGATAAGTTAACCGGTGGGAATGCGATCATAACTACTGGTGTAGGGCAACTTCAGATGTGGGCCGCACAGTTCTACAAGTACAATAGACCTCGACAATGGCTGACCTCCGTTGGGACAGGGGCCATGGGGTTCGGGCTACCTGCAGCCATGGGCGCATCTCTCGCAAAGCCTGATGAAGTCATCATTGACAC...

Protein

Download Protein FASTA

109 aa · TkA06G463790|TK1151|PROTEIN

MGHPLTFETFGDVIPPQYAIQVLDKLTGGNAIITTGVGQLQMWAAQFYKYNRPRQWLTSVGTGAMGFGLPAAMGASLAKPDEVIIDTSTNMIYGYTLPKHSSHTFDKKM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G463790`
TK1151 ID	TkA06G463790
OH-1004 ID	LXL04_009378
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.100
Protein coverage (%)	TK1151 77.064 / OH-1004 12.805 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G463790

Location Chr06:114777807-114778136 (+)

Description Similar to ALS SURA: Acetolactate synthase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48560`	Catalyzes the formation of acetolactate from pyruvate, the first step in valine and isoleucine biosynthesis.	A Mutation Causing Imidazolinone Resistance Maps to the Csr1 Locus of Arabidopsis thaliana.1990 · DOI: 10.1104/pp.92.4.1081 Expression, purification and characterization of Arabidopsis thaliana acetohydroxyacid synthase.1997 · DOI: 10.1042/bj3270161 Herbicide-resistant forms of Arabidopsis thaliana acetohydroxyacid synthase: characterization of the catalytic properties and sensitivity to inhibitors of four defined mutants.1998 · DOI: 10.1042/bj3330765

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009378 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009097 isoleucine biosynthetic process Biological Process

GO:0009099 L-valine biosynthetic process Biological Process

GO:0009635 response to herbicide Biological Process

GO:0005948 acetolactate synthase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003984 acetolactate synthase activity Molecular Function

GO:0030976 thiamine pyrophosphate binding Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT3G48560

bna:106353715

bna:106353716

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.457

Rank 1 · TkA06G463790 · TK1151

Peroxisome0.179

Rank 2 · TkA06G463790 · TK1151

Nucleus0.171

Rank 3 · TkA06G463790 · TK1151

Mitochondrion0.119

Rank 4 · TkA06G463790 · TK1151

Extracellular0.056

Rank 5 · TkA06G463790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02775TPP_enzyme_C36-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G463790	`PF02775`	TPP_enzyme_C	36	85	6.1e-17	62.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P17597`	Arabidopsis thaliana	sp\|P17597\|ILVB_ARATH Acetolactate synthase, chloroplastic	72.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card