RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G458160
Reference: TK1151 Chr: Chr06 Coordinates: 113312913-113314481 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1175 bp · TkA06G458160|TK1151|cDNA

CTCACGTGCGCGTGGGCAGGCTATCTGCCATTGTTGCTTCTGTTGAAGGCTGAAACTCTGAAACCACCGTCAGCAAAGGCTCTGACAAACGCTCTCTAATGGCAACACCCAATCATCTGAAATCGCATTCTGTCCGTCCATCTACTCATTTTTCTCACTCCGATACTGATGTTGGAGTGTTCTCCCAAAAACCCTATGTGAAATATGTCGCCAAAGAATCATTTAGGTTCTTTCTCCCTCTACTCACACTCAAGTTCTGA...

CDS

Download CDS FASTA

633 bp · TkA06G458160|TK1151|CDS

ATGGATCTAGAACCAGGGAGGTGTAGAAGAACAGACGGGAAGAAATGGCGGTGCCGCCTGGCGGTGCTTCCCGATCAAAAGTACTGTGACCGCCACATTCACAGAGGCTGCTTACGTTCAAGAAAGCCTGTGGAAGATCATAAACCTTTTTTCACCTCCGCCACAATTACCGTTTTGCCCCTGAAACCCGCCATCTCTCCAAAATCCGATACCAGAAATCATAATAAAAACAGCTTCAAAATCAAGAAACGGAGTAGGGA...

Protein

Download Protein FASTA

210 aa · TkA06G458160|TK1151|PROTEIN

MDLEPGRCRRTDGKKWRCRLAVLPDQKYCDRHIHRGCLRSRKPVEDHKPFFTSATITVLPLKPAISPKSDTRNHNKNSFKIKKRSREEDACGPLEFIFSPKSVLDKDSGTSSNKVNHEVAVPESVRCRRTDGKNWRCGTITLQGQKYCAQHMHRGAKKVHNHQNSNTTLSLSVGDSYGQKGNSDDDDDDDGGDPNGAAISSSSDATTISM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G458160
TK1151 IDTkA06G458160
OH-1004 IDLXL04_022721
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G458160
LocationChr06:113312913-113314481 (+)
DescriptionSimilar to GRF12: Growth-regulating factor 12
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g45480 Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. No verified direct reference in this release
At2g22840 Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. No verified direct reference in this release
At4g37740 Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0574500 Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. No verified direct reference in this release
Os02g0678800 Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022721 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0008285 negative regulation of cell population proliferation Biological Process
GO:0009409 response to cold Biological Process
GO:0009624 response to nematode Biological Process
GO:0009739 response to gibberellin Biological Process
GO:0019760 glucosinolate metabolic process Biological Process
GO:0032502 developmental process Biological Process
GO:0048364 root development Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT2G22840
ath:AT4G37740
dosa:Os04g0574500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974
Rank 1 · TkA06G458160 · TK1151
Cytoplasm0.080
Rank 2 · TkA06G458160 · TK1151
Cell membrane0.026
Rank 3 · TkA06G458160 · TK1151
Endoplasmic reticulum0.016
Rank 4 · TkA06G458160 · TK1151
Plastid0.013
Rank 5 · TkA06G458160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08879WRC4-45 aa
PF11722zf-TRM13_CCCH14-32 aa
PF12809Metallothi_Euk214-49 aa
PF13891zf-C3HC3H_KANSL217-34 aa
PF23570PHD_P30025-38 aa
PF12809Metallothi_Euk272-83 aa
PF11722zf-TRM13_CCCH79-86 aa
PF12809Metallothi_Euk2113-148 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G458160PF08879WRC4453.9e-35120.0
TkA06G458160PF11722zf-TRM13_CCCH14324.7e-0626.8
TkA06G458160PF12809Metallothi_Euk214491.110.4
TkA06G458160PF13891zf-C3HC3H_KANSL217340.03615.1
TkA06G458160PF23570PHD_P30025383.98.2
TkA06G458160PF12809Metallothi_Euk272831.110.4
TkA06G458160PF11722zf-TRM13_CCCH79864.7e-0626.8
TkA06G458160PF12809Metallothi_Euk21131481.110.4
TkA06G458160PF08879WRC1221623.9e-35120.0
TkA06G458160PF11722zf-TRM13_CCCH1331524.7e-0626.8
TkA06G458160PF13891zf-C3HC3H_KANSL21361560.03615.1
TkA06G458160PF23570PHD_P3001461543.98.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8S9M3Arabidopsis thalianasp|Q8S9M3|GRF9_ARATH Growth-regulating factor 930.500%Swiss-ProtMedium
O81001Arabidopsis thalianasp|O81001|GRF1_ARATH Growth-regulating factor 168.500%Swiss-ProtLow
Q8L8A8Arabidopsis thalianasp|Q8L8A8|GRF2_ARATH Growth-regulating factor 247.600%Swiss-ProtLow
Q6AWX7Oryza sativa subsp. japonicasp|Q6AWX7|GRF12_ORYSJ Growth-regulating factor 1258.200%Swiss-ProtLow
Q6EPP9Oryza sativa subsp. japonicasp|Q6EPP9|GRF10_ORYSJ Growth-regulating factor 1071.100%Swiss-ProtLow

JBrowse

View in Genome Browser