TkA06G458060 | RubberDandelionOmics

Gene overview

TkA06G458060

Reference: TK1151 Chr: Chr06 Coordinates: 113280446-113283130 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1555 bp · TkA06G458060|TK1151|cDNA

TAATGGTTTTTTTTTAAAAAAAATTGTTGCACTATTGACCAAAATATAATCAATTTTTGAATCAATTCGGACGATCTTTTACGTAGTTGCCCTCCGGTCCTCTTCTCCGAGACTCCCAGCTCCCAAGTCCCACCCATCATTCTTTCCCCTTCTCTCCCCGGTTCTTCGCCGACGTCTACATTCGTTATTATCTTGCACTGCCCGTCGCCATTCACCACTCCCGTAATCGCCGTCTCCATTCACCGTTTTCTTTCATATTC...

CDS

Download CDS FASTA

954 bp · TkA06G458060|TK1151|CDS

ATGGAGGAGTCAGCACAGAGAAAAGAAAGACTAAAAGCCATGAGAATGGAAGCTTCACAGGAGGGCCCCACGTATAACGAAGGTGGTGACCATTTAGCAGTTAGCCTCTCGAACCCACTTCTTGAACCCACGGCTAACCCCAGTGGTCAGGTGCACCAAGTGGCTCAGAGCTTTAACTATTACACCAACCCAATGGCAGCATACTCTGGGAACAAACAGAAGACCAAGGTCAGCCCTCAGATACCACACGACTATTCATC...

Protein

Download Protein FASTA

317 aa · TkA06G458060|TK1151|PROTEIN

MEESAQRKERLKAMRMEASQEGPTYNEGGDHLAVSLSNPLLEPTANPSGQVHQVAQSFNYYTNPMAAYSGNKQKTKVSPQIPHDYSSILPRQQTNDMFPSPSLQPHLSHSPIPRMHMPHGQYQNPNFSYTPQVQGGHPSPGGYRGPHFTTGPGQGNYPSPGPGYPLPGPSLGRGYGYRGPGPNHFRPGPNHGPGYSTPGPNQGRGQWLGNSRGRGTWSGQGQGRGGGRGAHNNNNHVTAEDRPDLFYNKSMVEDPWKFLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G458060`
TK1151 ID	TkA06G458060
OH-1004 ID	LXL04_022723
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G458060

Location Chr06:113280446-113283130 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24500`	Involved in miRNAs and siRNAs biogenesis and thus promotes gene silencing.	ROTUNDA3 function in plant development by phosphatase 2A-mediated regulation of auxin transporter recycling.2016 · DOI: 10.1073/pnas.1501343112

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022723 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000380 alternative mRNA splicing, via spliceosome Biological Process

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0030422 siRNA processing Biological Process

GO:0035196 miRNA processing Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

KEGG gene cross-reference

ath:AT4G24500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.825

Rank 1 · TkA06G458060 · TK1151

Cytoplasm0.319

Rank 2 · TkA06G458060 · TK1151

Cell membrane0.030

Rank 3 · TkA06G458060 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA06G458060 · TK1151

Mitochondrion0.023

Rank 5 · TkA06G458060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08315cwf182-45 aa

PF13865FoP_duplication197-241 aa

PF15502MPLKIP226-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G458060	`PF08315`	cwf18	2	45	0.36	12.1
TkA06G458060	`PF13865`	FoP_duplication	197	241	3.6	9.0
TkA06G458060	`PF15502`	MPLKIP	226	270	2.5e-07	31.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB47`	Arabidopsis thaliana	sp\|Q9SB47\|SIC_ARATH Protein SICKLE	32.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card