TkA06G457840 | RubberDandelionOmics

Gene overview

TkA06G457840

Reference: TK1151 Chr: Chr06 Coordinates: 113225840-113229050 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2048 bp · TkA06G457840|TK1151|cDNA

AATTATATTGATTCAAACGAGTTGATAATGCTTCCACCATTGTGCAGAGGCGGATATGGCGTTGGAGCTGGAAATGGAGCTTACTTCCGGCTGGCGTACCGCCAACGCCAATCACGAACAGAATGAATATAAAAGACGAAACTATTCGATCTTCGAACTCCCCTCGGATTTCTTCGATTCCTGCCGTTTTATTGATTTGCTTTCAACCCCTGAACTCACCAACAACCCTGCTACTACTACGGGGAATACCGTAGAAGAAG...

CDS

Download CDS FASTA

1188 bp · TkA06G457840|TK1151|CDS

ATGGCGTTGGAGCTGGAAATGGAGCTTACTTCCGGCTGGCGTACCGCCAACGCCAATCACGAACAGAATGAATATAAAAGACGAAACTATTCGATCTTCGAACTCCCCTCGGATTTCTTCGATTCCTGCCGTTTTATTGATTTGCTTTCAACCCCTGAACTCACCAACAACCCTGCTACTACTACGGGGAATACCGTAGAAGAAGGAGAGGCGGCTCAGGAGAGGAATGCTAGTTCTGGTGAGCAATGGACCTGTAATAC...

Protein

Download Protein FASTA

395 aa · TkA06G457840|TK1151|PROTEIN

MALELEMELTSGWRTANANHEQNEYKRRNYSIFELPSDFFDSCRFIDLLSTPELTNNPATTTGNTVEEGEAAQERNASSGEQWTCNTCKSSFDSLHDQRSHFKSDFHLFNIKQSIAEKDTVRDDDFDECASNSIVQNYEISSISGSENEENAEFGDSTTGLLGSTKQKIFVRLSNGGRISFWKCLLVGDSEKILFEHDSYGFIKDDNTPYVTLKEVTERLLNVIHEPRNNTCLRVMLLTSGGHFVGCVFEGKSIVAHKTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G457840`
TK1151 ID	TkA06G457840
OH-1004 ID	LXL04_026819
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	58.100
Protein coverage (%)	TK1151 93.924 / OH-1004 58.252 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G457840`
Location	Chr06:113225840-113229050 (-)
Description	Similar to ANKZF1: Ankyrin repeat and zinc finger domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026819` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001680 tRNA 3'-terminal CCA addition Biological Process GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process GO:0036503 ERAD pathway Biological Process GO:0042780 tRNA 3'-end processing Biological Process GO:0070301 cellular response to hydrogen peroxide Biological Process GO:0072344 rescue of stalled cytosolic ribosome Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0004521 RNA endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016787 hydrolase activity Molecular Function
KEGG gene cross-reference	hsa:55139 mmu:52231 rno:363255 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.501

Rank 1 · TkA06G457840 · TK1151

Nucleus0.464

Rank 2 · TkA06G457840 · TK1151

Mitochondrion0.094

Rank 3 · TkA06G457840 · TK1151

Cell membrane0.039

Rank 4 · TkA06G457840 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA06G457840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23250zf_DPOE_245-94 aa

PF12756zf-C2H2_281-118 aa

PF12756zf-C2H2_2196-233 aa

PF18826bVLRF1235-373 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G457840	`PF23250`	zf_DPOE_2	45	94	0.046	14.1
TkA06G457840	`PF12756`	zf-C2H2_2	81	118	0.042	14.8
TkA06G457840	`PF12756`	zf-C2H2_2	196	233	0.042	14.8
TkA06G457840	`PF18826`	bVLRF1	235	373	3.9e-44	150.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card