RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G457360
Reference: TK1151 Chr: Chr06 Coordinates: 113076396-113094893 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

5947 bp · TkA06G457360|TK1151|cDNA

ATTAACTGATAACATCCATCCCAAACGATCGCCTTCTTCAACAACGACTCCCGATCAATCGTCGAGTTCAACAACAACTGAGATTCAATAATCCTAACATCCATCCCAAAGATGGTCTGGTGCATGTCCGGAGACACCATATTGTTTCAACGTGGATTTACACCGCTTCATTGAAGTATTTGAAGCGACGGAAACCATTTGCAACCAACGATGAAATCAGAAAAAGCTGCTAAACACCAACTAACATATCAGCATCAAGC...

CDS

Download CDS FASTA

3117 bp · TkA06G457360|TK1151|CDS

ATGGAAAAGTTTGCAGAACGCTATTGTATATGTAATCCCAAGGCGTTTATTAGTGCTGATACGGCTTATGTTCTTGCTTACTCTGTTATTATGCTAAATACTGATGCTCATAATCCCATGGTCAAGAATAAGATGTCAGCTGATGACTTCATAAGAAACAACCGTGGCATAGATGACGGAAAAGATTTACCAGAGGAGTACCTGCGATCATTATTCGAACGAATATCAAGAAGTGAGATAAAAATGAAAGAAGACGATTT...

Protein

Download Protein FASTA

1038 aa · TkA06G457360|TK1151|PROTEIN

MEKFAERYCICNPKAFISADTAYVLAYSVIMLNTDAHNPMVKNKMSADDFIRNNRGIDDGKDLPEEYLRSLFERISRSEIKMKEDDLALQQSLSVNSNKILGLDSILNIVVRKRDEETHTSEDLMRHMQQQFQEKARRSESVYYAATDVFILRYMIEVCWAPMLVAFSVPLDKSDDVIVITKCLEGFRHAVHVTSAMSMKTHRDAFVTSLAKFTSLHSPADIKQKNIDAIKVIVTIADEDGDYLQEAWEHILTCISRFEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G457360
TK1151 IDTkA06G457360
OH-1004 IDLXL04_022727
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.400
Protein coverage (%)TK1151 100.000 / OH-1004 58.810
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G457360
LocationChr06:113076396-113094893 (+)
DescriptionSimilar to BIG2: Brefeldin A-inhibited guanine nucleotide-exchange protein 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g60860 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release
At1g01960 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release
At4g38200 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release
At4g35380 Activates the ARF proteins by exchanging bound GDP for free GTP. No verified direct reference in this release
At3g43300 Activates the ARF proteins by exchanging bound GDP for free GTP.
Effector-triggered immunity blocks pathogen degradation of an immunity-associated vesicle traffic regulator in Arabidopsis.2011 · DOI: 10.1073/pnas.1103338108

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022727 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0001881 receptor recycling Biological Process
GO:0006887 exocytosis Biological Process
GO:0006893 Golgi to plasma membrane transport Biological Process
GO:0007032 endosome organization Biological Process
GO:0009561 megagametogenesis Biological Process
GO:0010256 endomembrane system organization Biological Process
GO:0015031 protein transport Biological Process
GO:0016192 vesicle-mediated transport Biological Process
GO:0032012 regulation of ARF protein signal transduction Biological Process
GO:0032760 positive regulation of tumor necrosis factor production Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0043001 Golgi to plasma membrane protein transport Biological Process
KEGG gene cross-reference
ath:AT1G01960
ath:AT3G60860
ath:AT4G35380
ath:AT4G38200
hsa:10564
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.454
Rank 1 · TkA06G457360 · TK1151
Golgi apparatus0.414
Rank 2 · TkA06G457360 · TK1151
Cell membrane0.169
Rank 3 · TkA06G457360 · TK1151
Lysosome / Vacuole0.142
Rank 4 · TkA06G457360 · TK1151
Endoplasmic reticulum0.127
Rank 5 · TkA06G457360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01369Sec71-80 aa
PF02916DNA_PPF194-251 aa
PF09324Sec7-like_HDS217-257 aa
PF20252BIG2_C336-359 aa
PF23325TPR_28359-416 aa
PF09324Sec7-like_HDS385-415 aa
PF16206Mon2_C399-449 aa
PF21822Phage_TAC_15441-525 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G457360PF01369Sec71802.6e-32112.6
TkA06G457360PF02916DNA_PPF1942510.09613.5
TkA06G457360PF09324Sec7-like_HDS2172579.3e-31106.3
TkA06G457360PF20252BIG2_C3363596.2e-39134.5
TkA06G457360PF23325TPR_283594166.5e-0833.4
TkA06G457360PF09324Sec7-like_HDS3854159.3e-31106.3
TkA06G457360PF16206Mon2_C3994492.5e-0833.3
TkA06G457360PF21822Phage_TAC_154415250.01816.3
TkA06G457360PF09324Sec7-like_HDS4435259.3e-31106.3
TkA06G457360PF28349HSF2BP_C4564801.310.2
TkA06G457360PF23325TPR_284604966.5e-0833.4
TkA06G457360PF02985HEAT4624870.02815.4
TkA06G457360PF20252BIG2_C5185566.2e-39134.5
TkA06G457360PF16206Mon2_C5426902.5e-0833.3
TkA06G457360PF23325TPR_286267326.5e-0833.4
TkA06G457360PF02985HEAT6296580.02815.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LZX8Arabidopsis thalianasp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 267.100%Swiss-ProtHigh
Q9LPC5Arabidopsis thalianasp|Q9LPC5|BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 363.800%Swiss-ProtHigh
F4JSZ5Arabidopsis thalianasp|F4JSZ5|BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 147.800%Swiss-ProtMedium
F4JN05Arabidopsis thalianasp|F4JN05|BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 446.700%Swiss-ProtMedium
F4IXW2Arabidopsis thalianasp|F4IXW2|BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 532.900%Swiss-ProtMedium

JBrowse

View in Genome Browser