TkA06G456980 | RubberDandelionOmics

Gene overview

TkA06G456980

Reference: TK1151 Chr: Chr06 Coordinates: 112957146-112959606 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

801 bp · TkA06G456980|TK1151|cDNA

AAAAAAAGTGGATTCACATTAGACTTTAGATCATCAACGACATCAAGATTCCGAACCCCATTGAAGACTTCTGGAGTTTTTCCTTTTTGTCCGTCATTAAAACACACACAGAGAGAGGGGTTTAGAGATGGGAGATCTAATCGCATGGCTCTTCTCCTTCTTCCTCCTCATAGCACTCATAGCCCTTGTTCTTTACCAGATAATGTGCTTTTTAGACTTAGAGACTGATTATATCAACCCATATGAGTTAGCAAGTAAGA...

CDS

Download CDS FASTA

408 bp · TkA06G456980|TK1151|CDS

ATGGGAGATCTAATCGCATGGCTCTTCTCCTTCTTCCTCCTCATAGCACTCATAGCCCTTGTTCTTTACCAGATAATGTGCTTTTTAGACTTAGAGACTGATTATATCAACCCATATGAGTTAGCAAGTAAGATTAACTTCATTATGTTGCCAGAGTTTATTACTCAAGGAGGATTGTGCTTTCTACATCTTGTCACACGCCATTGGATCATGTTCCTATTATGCCTCCCATATTTATATTACAATGTGAATTTGTACAT...

Protein

Download Protein FASTA

135 aa · TkA06G456980|TK1151|PROTEIN

MGDLIAWLFSFFLLIALIALVLYQIMCFLDLETDYINPYELASKINFIMLPEFITQGGLCFLHLVTRHWIMFLLCLPYLYYNVNLYIHGRHVVYATEVFSDLSKQKKHRIFKLIYLAVLTVFSIFWMILSIIDEE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G456980`
TK1151 ID	TkA06G456980
OH-1004 ID	LXL04_026530
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.100
Protein coverage (%)	TK1151 100.000 / OH-1004 31.690 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G456980

Location Chr06:112957146-112959606 (+)

Description Similar to At1g12390: Protein cornichon homolog 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12390`	Protein cornichon homolog 4.	No verified direct reference in this release
`At1g62880`	Protein cornichon homolog 3.	No verified direct reference in this release
`At1g12340`	Probable protein cornichon homolog 2.	No verified direct reference in this release
`At4g12090`	Protein cornichon homolog 5.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0136500`	May act as a cargo receptor in vesicular transport of HKT1;3 and other proteins from the endoplasmic reticulum to the Golgi apparatus.	Identification of rice cornichon as a possible cargo receptor for the Golgi-localized sodium transporter OsHKT1;3.2015 · DOI: 10.1093/jxb/erv069

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026530 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005102 signaling receptor binding Molecular Function

GO:0038024 cargo receptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G12340

ath:AT1G12390

ath:AT1G62880

ath:AT4G12090

dosa:Os06g0136500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.541

Rank 1 · TkA06G456980 · TK1151

Golgi apparatus0.325

Rank 2 · TkA06G456980 · TK1151

Cytoplasm0.158

Rank 3 · TkA06G456980 · TK1151

Cell membrane0.089

Rank 4 · TkA06G456980 · TK1151

Lysosome / Vacuole0.073

Rank 5 · TkA06G456980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03311Cornichon5-125 aa

PF06550SPP11-76 aa

PF11124Pho8612-20 aa

PF11124Pho8663-134 aa

PF06550SPP92-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G456980	`PF03311`	Cornichon	5	125	6e-39	133.8
TkA06G456980	`PF06550`	SPP	11	76	0.75	10.0
TkA06G456980	`PF11124`	Pho86	12	20	1.0	9.4
TkA06G456980	`PF11124`	Pho86	63	134	1.0	9.4
TkA06G456980	`PF06550`	SPP	92	132	0.75	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W04`	Arabidopsis thaliana	sp\|Q84W04\|CNIH4_ARATH Protein cornichon homolog 4	55.200%	Swiss-Prot	High
`Q8GWT5`	Arabidopsis thaliana	sp\|Q8GWT5\|CNIH3_ARATH Protein cornichon homolog 3	50.700%	Swiss-Prot	High
`Q3EDD7`	Arabidopsis thaliana	sp\|Q3EDD7\|CNIH2_ARATH Probable protein cornichon homolog 2	53.100%	Swiss-Prot	High
`Q9SZ74`	Arabidopsis thaliana	sp\|Q9SZ74\|CNIH5_ARATH Protein cornichon homolog 5	41.000%	Swiss-Prot	Medium
`Q0DET3`	Oryza sativa subsp. japonica	sp\|Q0DET3\|CNIH1_ORYSJ Protein cornichon homolog 1	49.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card