LXL04_026530 | RubberDandelionOmics

Gene overview

LXL04_026530

Reference: OH-1004 Chr: Chr05 Coordinates: 127863437-127867936 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · LXL04_026530|LXL04_026530|OH1004|cDNA

ATGTCAGAGATGGCTTTCCGTCGAAGAATTCCGGTCAATCGGAGAATCAAACCACCTCATCCATCCCCTTCTGCTCACAGGAAAGCTGTAAATATCCATCGATCGTCAAATTCGAAGAAGCATTTAAAATTCATTAAAAGATGCAACTCCGAGCCTACTTTATTGACCGCTGGTATCTCTATCGCCGGTGCTGGTGTTGACGTCGGCGACGATCATCCGTATATGACTCCGTCAGATGAAAGTGGCTCGATTTTTCGAAC...

CDS

Download CDS FASTA

1281 bp · LXL04_026530|LXL04_026530|OH1004|CDS

ATGTCAGAGATGGCTTTCCGTCGAAGAATTCCGGTCAATCGGAGAATCAAACCACCTCATCCATCCCCTTCTGCTCACAGGAAAGCTGTAAATATCCATCGATCGTCAAATTCGAAGAAGCATTTAAAATTCATTAAAAGATGCAACTCCGAGCCTACTTTATTGACCGCTGGTATCTCTATCGCCGGTGCTGGTGTTGACGTCGGCGACGATCATCCGTATATGACTCCGTCAGATGAAAGTGGCTCGATTTTTCGAAC...

Protein

Download Protein FASTA

426 aa · LXL04_026530|LXL04_026530|OH1004|PROTEIN

MSEMAFRRRIPVNRRIKPPHPSPSAHRKAVNIHRSSNSKKHLKFIKRCNSEPTLLTAGISIAGAGVDVGDDHPYMTPSDESGSIFRTRTSTDVFSSSPDLLPNSPEKSKGYNKDAKVVVKVMVEGSPGPIRALVKLGSSVEETIRLVMNKYNAEGRSPQIHQHVINSFELHHSYFSLDKSNMIGEIGSRSFYMRKSANDKEDICSNTSIVEASNDDSLPSSSNIFFNAHVCQEYNKIIKVTSKIWSFLGCFDKAKMVLDR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026530`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026530

Location Chr05:127863437-127867936 (-)

Description Similar to At1g12390: Protein cornichon homolog 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12390`	Protein cornichon homolog 4.	No verified direct reference in this release
`At1g62880`	Protein cornichon homolog 3.	No verified direct reference in this release
`At1g12340`	Probable protein cornichon homolog 2.	No verified direct reference in this release
`At4g12090`	Protein cornichon homolog 5.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0136500`	May act as a cargo receptor in vesicular transport of HKT1;3 and other proteins from the endoplasmic reticulum to the Golgi apparatus.	Identification of rice cornichon as a possible cargo receptor for the Golgi-localized sodium transporter OsHKT1;3.2015 · DOI: 10.1093/jxb/erv069

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026530 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005102 signaling receptor binding Molecular Function

GO:0038024 cargo receptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G12340

ath:AT1G12390

ath:AT1G62880

ath:AT4G12090

dosa:Os06g0136500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.323

Rank 1 · LXL04_026530 · OH-1004

Endoplasmic reticulum0.309

Rank 2 · LXL04_026530 · OH-1004

Golgi apparatus0.179

Rank 3 · LXL04_026530 · OH-1004

Nucleus0.174

Rank 4 · LXL04_026530 · OH-1004

Cytoplasm0.172

Rank 5 · LXL04_026530 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23156.2DUF7054113-194 aa

PF03311.20Cornichon294-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026530	`PF23156.2`	DUF7054	113	194	3.7e-27	94.8
LXL04_026530	`PF03311.20`	Cornichon	294	414	1.7e-42	145.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W04`	Arabidopsis thaliana	Protein cornichon homolog 4	65.441%	Swiss-Prot	weak database homology
`Q8GWT5`	Arabidopsis thaliana	Protein cornichon homolog 3	64.706%	Swiss-Prot	weak database homology
`Q3EDD7`	Arabidopsis thaliana	Probable protein cornichon homolog 2	68.696%	Swiss-Prot	weak database homology
`Q9SZ74`	Arabidopsis thaliana	Protein cornichon homolog 5	50.746%	Swiss-Prot	weak database homology
`Q0DET3`	Oryza sativa subsp. japonica	Protein cornichon homolog 1	61.194%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card