TkA06G445400 | RubberDandelionOmics

Gene overview

TkA06G445400

Reference: TK1151 Chr: Chr06 Coordinates: 110068207-110070503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1066 bp · TkA06G445400|TK1151|cDNA

ATTTTTTTCACAATCTGAAGATAAGCCAAGGAAAAAGCCTATCGTCTCCATCTTAACGCAAGCACTCGCTGCTCTCAATAGCTCTCAATAGCTCTCAAAGCTGTGCAGCATGCCGATGCTCTCGTCTCCATCTCTTCAGCTCAAGCCTTCCTTCTCATTTTCACATCGATCCCTCACATCTTTTCCTCCTACCCTAAACCAAAAGAAGTACTTCCTCCATTGTTGCACGACCTGCAACTTGAAGGACGAAAGTGAACAGA...

CDS

Download CDS FASTA

762 bp · TkA06G445400|TK1151|CDS

ATGCCGATGCTCTCGTCTCCATCTCTTCAGCTCAAGCCTTCCTTCTCATTTTCACATCGATCCCTCACATCTTTTCCTCCTACCCTAAACCAAAAGAAGTACTTCCTCCATTGTTGCACGACCTGCAACTTGAAGGACGAAAGTGAACAGAATGGAAGTAAGGAGAATTTGAAGGGGAGAAGACTCATTATGTTTCTGGTCTCTTTAGGCATATTTCCAACTTTGCCCTCCTTTGGGAAAACAAAAATGAAAAACCCGTA...

Protein

Download Protein FASTA

253 aa · TkA06G445400|TK1151|PROTEIN

MPMLSSPSLQLKPSFSFSHRSLTSFPPTLNQKKYFLHCCTTCNLKDESEQNGSKENLKGRRLIMFLVSLGIFPTLPSFGKTKMKNPYDEKRLLEQNKRVQRENNAPDDFPSFVREGFEVKVVASDKYVKCDSGLIYRDFEVGDGDVPKSGQQVTFHYIGYNESGRRIDSSYQQGSPAKIRMGTNALVPGFEEGIKDMKPGGKRRIIIPPELGPPVGPSTFFSAKQFEVFDVELLGVKDCTRRTIAFYSDVVCD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G445400`
TK1151 ID	TkA06G445400
OH-1004 ID	LXL04_022789
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G445400

Location Chr06:110068207-110070503 (-)

Description Similar to FKBP20-2: Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60370`	PPIases accelerate the folding of proteins.	A redox-active FKBP-type immunophilin functions in accumulation of the photosystem II supercomplex in Arabidopsis thaliana.2006 · DOI: 10.1073/pnas.0605452103
`At5g13410`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022789 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010207 photosystem II assembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0003755 peptidyl-prolyl cis-trans isomerase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT2G43560

ath:AT3G60370

nma:NMA0273

nme:NMB0027

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA06G445400 · TK1151

Mitochondrion0.034

Rank 2 · TkA06G445400 · TK1151

Nucleus0.023

Rank 3 · TkA06G445400 · TK1151

Cytoplasm0.013

Rank 4 · TkA06G445400 · TK1151

Cell membrane0.010

Rank 5 · TkA06G445400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23322PPIase_AIP34-47 aa

PF23322PPIase_AIP142-199 aa

PF00254FKBP_C147-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G445400	`PF23322`	PPIase_AIP	34	47	0.052	14.6
TkA06G445400	`PF23322`	PPIase_AIP	142	199	0.052	14.6
TkA06G445400	`PF00254`	FKBP_C	147	212	2e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WRJ7`	Arabidopsis thaliana	sp\|Q0WRJ7\|FK202_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic	72.900%	Swiss-Prot	High
`Q9LYR5`	Arabidopsis thaliana	sp\|Q9LYR5\|FKB19_ARATH Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic	29.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card