TkA06G442780 | RubberDandelionOmics

Gene overview

TkA06G442780

Reference: TK1151 Chr: Chr06 Coordinates: 109408996-109413521 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1297 bp · TkA06G442780|TK1151|cDNA

CTAGGACAAGAGAAGAAGATGGAGAAATCCATGGGGGATTCGCGTAGCAACAGAGCAGCTGTTCAAGCTACAAATGACGATGCTTCCGCCAGCAAATTGTCTTGTGTTAAGAAAAATTATATCAAAGATGACTATGTACATTTGTTTGTAAGGAGGCCTGTGAGGAGATCTCCAATTATAAATCGTGGTTACTTTGCTCGTTGGTCAACTTTCCGGAAGATTCTTCACCAATTTCTGAATTCTGAGACAAAATCAAATGA...

CDS

Download CDS FASTA

1044 bp · TkA06G442780|TK1151|CDS

ATGGAGAAATCCATGGGGGATTCGCGTAGCAACAGAGCAGCTGTTCAAGCTACAAATGACGATGCTTCCGCCAGCAAATTGTCTTGTGTTAAGAAAAATTATATCAAAGATGACTATGTACATTTGTTTGTAAGGAGGCCTGTGAGGAGATCTCCAATTATAAATCGTGGTTACTTTGCTCGTTGGTCAACTTTCCGGAAGATTCTTCACCAATTTCTGAATTCTGAGACAAAATCAAATGAAGGTCATGTGAAAAAGCA...

Protein

Download Protein FASTA

347 aa · TkA06G442780|TK1151|PROTEIN

MEKSMGDSRSNRAAVQATNDDASASKLSCVKKNYIKDDYVHLFVRRPVRRSPIINRGYFARWSTFRKILHQFLNSETKSNEGHVKKQILSLGAGFDTTYFQLQDEGKAPHLYVELDFKEVTCKKTTIIETSNQLREKISASASICREKGELISDNYKLLPVDLRDIQSLNELILAHMDPSLPTFIIAECVLIYLDPESSRAIVQWASTTFSTSIFFVYEQILPHDAFGQQMIRNLESRGCGLLGIYDTPTLHDKEKLFLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G442780`
TK1151 ID	TkA06G442780
OH-1004 ID	LXL04_022803
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G442780

Location Chr06:109408996-109413521 (+)

Description Similar to LCMT1: Leucine carboxyl methyltransferase 1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02100`	Methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A (PP2A) catalytic subunits to form alpha-leucine ester residues (Probable).	Methylation of a phosphatase specifies dephosphorylation and degradation of activated brassinosteroid receptors.2011 · DOI: 10.1126/scisignal.2001258 Methylation of protein phosphatase 2A-Influence of regulators and environmental stress factors.2017 · DOI: 10.1111/pce.13038

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022803 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000086 G2/M transition of mitotic cell cycle Biological Process

GO:0006400 tRNA modification Biological Process

GO:0006479 protein methylation Biological Process

GO:0006481 C-terminal protein methylation Biological Process

GO:0030488 tRNA methylation Biological Process

GO:0031333 negative regulation of protein-containing complex assembly Biological Process

GO:0031591 wybutosine biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0036211 protein modification process Biological Process

GO:0090266 regulation of mitotic cell cycle spindle assembly checkpoint Biological Process

GO:1900458 negative regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G02100

bta:618021

hsa:51451

hsa:9836

mmu:329504

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.710

Rank 1 · TkA06G442780 · TK1151

Nucleus0.475

Rank 2 · TkA06G442780 · TK1151

Mitochondrion0.066

Rank 3 · TkA06G442780 · TK1151

Cell membrane0.035

Rank 4 · TkA06G442780 · TK1151

Peroxisome0.035

Rank 5 · TkA06G442780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04072LCM46-205 aa

PF12712DUF380567-170 aa

PF12712DUF3805286-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G442780	`PF04072`	LCM	46	205	7.9e-21	75.5
TkA06G442780	`PF12712`	DUF3805	67	170	0.035	14.9
TkA06G442780	`PF12712`	DUF3805	286	315	0.035	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY08`	Arabidopsis thaliana	sp\|Q8VY08\|LCMT1_ARATH Leucine carboxyl methyltransferase 1 homolog	74.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card