TkA06G442700 | RubberDandelionOmics

Gene overview

TkA06G442700

Reference: TK1151 Chr: Chr06 Coordinates: 109388175-109388882 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · TkA06G442700|TK1151|cDNA

ATGAAAACCGATCAAGAAATCTTGAAGAATTTGGAAACATCGGGTTCATTGATCACACCATGCTTTAGCGACGAACTCGACTGGTCGCTTAATCTTGAAGATCTCGACCTGAGTTTTATTCATGACATTATCAGTGAAACTCCTTCTCCCGTCACAGATTCTTCCGATGATCTAAATATTGGGGTTACAAATGTTGAGTTTTTAGGCATCACCCCTTTACTCCAACAGCCCCAATCAAATTCAGAAAAAATTCCGGCCAT...

CDS

Download CDS FASTA

675 bp · TkA06G442700|TK1151|CDS

ATGAAAACCGATCAAGAAATCTTGAAGAATTTGGAAACATCGGGTTCATTGATCACACCATGCTTTAGCGACGAACTCGACTGGTCGCTTAATCTTGAAGATCTCGACCTGAGTTTTATTCATGACATTATCAGTGAAACTCCTTCTCCCGTCACAGATTCTTCCGATGATCTAAATATTGGGGTTACAAATGTTGAGTTTTTAGGCATCACCCCTTTACTCCAACAGCCCCAATCAAATTCAGAAAAAATTCCGGCCAT...

Protein

Download Protein FASTA

224 aa · TkA06G442700|TK1151|PROTEIN

MKTDQEILKNLETSGSLITPCFSDELDWSLNLEDLDLSFIHDIISETPSPVTDSSDDLNIGVTNVEFLGITPLLQQPQSNSEKIPAMDVASNWDFTTGQCKKVVSVRQDPLPSPPKRRYRGVRLRPWGKFSAEMRNPEKKGRRLWLGTYDTAEEAGMAYDRAAFKYRGCHAVLNFPHLIGSHDVSPEKYTIKKRLRKSECSSSSPPPPESPINSLRNRKKRTAM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G442700`
TK1151 ID	TkA06G442700
OH-1004 ID	LXL04_022804
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 97.917 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G442700

Location Chr06:109388175-109388882 (+)

Description Similar to ERF2: Ethylene-responsive transcription factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44840`	Acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022804 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G44840

nsy:104217398

nta:107769743

nta:107825044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · TkA06G442700 · TK1151

Cytoplasm0.107

Rank 2 · TkA06G442700 · TK1151

Cell membrane0.024

Rank 3 · TkA06G442700 · TK1151

Plastid0.015

Rank 4 · TkA06G442700 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA06G442700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP2102-110 aa

PF00847AP2118-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G442700	`PF00847`	AP2	102	110	6.8e-14	52.6
TkA06G442700	`PF00847`	AP2	118	168	6.8e-14	52.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9K1`	Arabidopsis thaliana	sp\|Q8L9K1\|ERF99_ARATH Ethylene-responsive transcription factor 13	61.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card