TkA06G441480 | RubberDandelionOmics

Gene overview

TkA06G441480

Reference: TK1151 Chr: Chr06 Coordinates: 109094487-109100252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2697 bp · TkA06G441480|TK1151|cDNA

ATGGGAAAACATCAGAAACTCAAAGCAAGTGATCGACGGAAGTTCTGTAAAGTTGTGATGAAAGATGATAAAGAGGAAGATGACAAATATCAAGACATTGAATCTGATTTCTCAGTTTCAGTTTCTGAATATAACTCTCCTATTCCGGCAATGAATACCGGAAACAAACACGATGACGGCGATAAAAATAGATATAGTCTAAGCGATATAATGTCATCATCAAAGTCTAAAAATCCATCAATCGGAAACGGAATTCGCCC...

CDS

Download CDS FASTA

2697 bp · TkA06G441480|TK1151|CDS

ATGGGAAAACATCAGAAACTCAAAGCAAGTGATCGACGGAAGTTCTGTAAAGTTGTGATGAAAGATGATAAAGAGGAAGATGACAAATATCAAGACATTGAATCTGATTTCTCAGTTTCAGTTTCTGAATATAACTCTCCTATTCCGGCAATGAATACCGGAAACAAACACGATGACGGCGATAAAAATAGATATAGTCTAAGCGATATAATGTCATCATCAAAGTCTAAAAATCCATCAATCGGAAACGGAATTCGCCC...

Protein

Download Protein FASTA

898 aa · TkA06G441480|TK1151|PROTEIN

MGKHQKLKASDRRKFCKVVMKDDKEEDDKYQDIESDFSVSVSEYNSPIPAMNTGNKHDDGDKNRYSLSDIMSSSKSKNPSIGNGIRPIKQLQNGIFITTPKDFSAKTVCPLYRKEYIRDRKVVSTESFFHHQEYENEKDTYDVNRVVTNNCDFGDEEPFSLSDPKFQFVLPSKIANMLYPHQREGLKWHWSLHCNGKGGILGDDMGLGKTMQICAFLAGLFHSKLIKRVLIVAPKTLLPHWKKELGVVGLSEKTREFFGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G441480`
TK1151 ID	TkA06G441480
OH-1004 ID	LXL04_022833
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G441480

Location Chr06:109094487-109100252 (-)

Description Similar to CHR24: Protein CHROMATIN REMODELING 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63950`	DNA helicase that acts as an essential component of the spindle assembly checkpoint (By similarity).	A transient assay for recombination demonstrates that Arabidopsis SNM1 and XRCC3 enhance non-homologous recombination.2011 · DOI: 10.4238/vol10-3gmr1347

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0692750`	DNA helicase that acts as an essential component of the spindle assembly checkpoint (By similarity).	Rice SNF2 family helicase ENL1 is essential for syncytial endosperm development.2015 · DOI: 10.1111/tpj.12705

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022833 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0010965 regulation of mitotic sister chromatid separation Biological Process

GO:0016539 intein-mediated protein splicing Biological Process

GO:0045951 positive regulation of mitotic recombination Biological Process

GO:0051301 cell division Biological Process

GO:2000014 regulation of endosperm development Biological Process

GO:0000776 kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G63950

bta:782916

dosa:Os04g0692750

dre:100005291

mmu:236930

osa:9266414

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.811

Rank 1 · TkA06G441480 · TK1151

Cytoplasm0.210

Rank 2 · TkA06G441480 · TK1151

Mitochondrion0.046

Rank 3 · TkA06G441480 · TK1151

Cell membrane0.027

Rank 4 · TkA06G441480 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA06G441480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04851ResIII178-325 aa

PF00176SNF2-rel_dom181-460 aa

PF28555Helicase_dom190-236 aa

PF13872AAA_34197-331 aa

PF28555Helicase_dom300-322 aa

PF11496HDA2-3529-662 aa

PF00271Helicase_C537-644 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G441480	`PF04851`	ResIII	178	325	8.2e-09	36.3
TkA06G441480	`PF00176`	SNF2-rel_dom	181	460	3.4e-58	197.7
TkA06G441480	`PF28555`	Helicase_dom	190	236	0.15	12.0
TkA06G441480	`PF13872`	AAA_34	197	331	6.4e-07	29.3
TkA06G441480	`PF28555`	Helicase_dom	300	322	0.15	12.0
TkA06G441480	`PF11496`	HDA2-3	529	662	6.9e-05	22.9
TkA06G441480	`PF00271`	Helicase_C	537	644	6.7e-25	88.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W103`	Arabidopsis thaliana	sp\|Q8W103\|CHR24_ARATH Protein CHROMATIN REMODELING 24	62.100%	Swiss-Prot	High
`A0A0P0WGX7`	Oryza sativa subsp. japonica	sp\|A0A0P0WGX7\|ENL1_ORYSJ SNF2 domain-containing protein ENL1	59.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card